Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5GGU2

Protein Details
Accession C5GGU2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-29DEKDDDECARRKKRRGGKRASGPSARGBasic
NLS Segment(s)
PositionSequence
12-29RRKKRRGGKRASGPSARG
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDDEKDDDECARRKKRRGGKRASGPSARGRIDAAYGTVAAGGRRTLAVKQHRSPDQAASTSAGVHWPIGVVCGARAAGDRAASRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.8
4 0.83
5 0.85
6 0.85
7 0.88
8 0.89
9 0.87
10 0.81
11 0.74
12 0.7
13 0.66
14 0.56
15 0.46
16 0.36
17 0.29
18 0.26
19 0.22
20 0.15
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.05
27 0.05
28 0.05
29 0.04
30 0.05
31 0.06
32 0.06
33 0.13
34 0.22
35 0.28
36 0.32
37 0.39
38 0.42
39 0.45
40 0.45
41 0.43
42 0.38
43 0.33
44 0.3
45 0.25
46 0.22
47 0.19
48 0.17
49 0.13
50 0.1
51 0.09
52 0.08
53 0.06
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.1
64 0.11
65 0.14