Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094D4N5

Protein Details
Accession A0A094D4N5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-45TSFRKQNTPKTPLPKINCRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14.333, cyto 8.5, cyto_mito 5.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
IPR002618  UDPGP_fam  
IPR016267  UDPGP_trans  
Gene Ontology GO:0003983  F:UTP:glucose-1-phosphate uridylyltransferase activity  
GO:0006011  P:UDP-glucose metabolic process  
Pfam View protein in Pfam  
PF01704  UDPGP  
CDD cd00897  UGPase_euk  
Amino Acid Sequences MEITVASSSFTLQNPSCAVDIESAATSFRKQNTPKTPLPKINCRYSPSSALGAGNDGGPDSVPRHHGKSQSHVAFENTSTSIAASQMRNHLNKLSDTVSDEQEKKLFETEMDNFFALFRRYLNDKAKGSTLDWDRIAPPAEGQVVDYNDLANSESVSFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYSVNVPFVLMNSFNTDSDTENIIKKYEGHSIDIMTFNQSRYPRVLKDSLLPVPKSFDSSITDWYPPGHGDVFESLYNSGILDKLIARGVEIVFLSNVDNLGAVVDLRILQHMVETKSEYIMELTDKTKADVKGGTIIDYDGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLEAVKRVVMNNELEMEIIPNNKSIPADKKGESDVSIVQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYSLKHGQLQIDPTRFGPAPLIKLGTDFKKVSDFQKHIPSIPKILELDHLTITGAVNLGRGVTFKGTVIIVATEGSTIDIPPGSILENVVVQGSLRLLEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.21
5 0.22
6 0.17
7 0.18
8 0.16
9 0.16
10 0.14
11 0.14
12 0.14
13 0.16
14 0.19
15 0.23
16 0.3
17 0.34
18 0.44
19 0.53
20 0.61
21 0.67
22 0.71
23 0.76
24 0.76
25 0.8
26 0.8
27 0.77
28 0.79
29 0.77
30 0.73
31 0.7
32 0.66
33 0.64
34 0.57
35 0.53
36 0.45
37 0.39
38 0.34
39 0.29
40 0.24
41 0.18
42 0.14
43 0.12
44 0.09
45 0.08
46 0.09
47 0.09
48 0.12
49 0.17
50 0.21
51 0.27
52 0.32
53 0.39
54 0.42
55 0.49
56 0.56
57 0.55
58 0.54
59 0.5
60 0.48
61 0.42
62 0.39
63 0.33
64 0.24
65 0.2
66 0.17
67 0.15
68 0.13
69 0.13
70 0.16
71 0.15
72 0.17
73 0.24
74 0.31
75 0.32
76 0.34
77 0.36
78 0.35
79 0.34
80 0.35
81 0.29
82 0.24
83 0.27
84 0.28
85 0.27
86 0.3
87 0.31
88 0.29
89 0.3
90 0.29
91 0.26
92 0.26
93 0.22
94 0.17
95 0.22
96 0.24
97 0.25
98 0.26
99 0.25
100 0.22
101 0.22
102 0.24
103 0.19
104 0.15
105 0.12
106 0.14
107 0.18
108 0.26
109 0.33
110 0.38
111 0.39
112 0.41
113 0.43
114 0.42
115 0.39
116 0.39
117 0.35
118 0.32
119 0.31
120 0.3
121 0.27
122 0.28
123 0.29
124 0.21
125 0.17
126 0.15
127 0.15
128 0.13
129 0.14
130 0.15
131 0.14
132 0.15
133 0.15
134 0.13
135 0.11
136 0.12
137 0.11
138 0.07
139 0.07
140 0.06
141 0.07
142 0.07
143 0.09
144 0.09
145 0.09
146 0.1
147 0.1
148 0.11
149 0.11
150 0.15
151 0.14
152 0.14
153 0.15
154 0.15
155 0.13
156 0.13
157 0.11
158 0.08
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.05
168 0.1
169 0.12
170 0.13
171 0.14
172 0.16
173 0.16
174 0.17
175 0.18
176 0.13
177 0.11
178 0.1
179 0.08
180 0.1
181 0.09
182 0.09
183 0.1
184 0.1
185 0.1
186 0.12
187 0.13
188 0.15
189 0.18
190 0.19
191 0.18
192 0.18
193 0.19
194 0.22
195 0.24
196 0.2
197 0.17
198 0.16
199 0.15
200 0.15
201 0.16
202 0.11
203 0.09
204 0.11
205 0.12
206 0.11
207 0.12
208 0.13
209 0.13
210 0.14
211 0.16
212 0.14
213 0.15
214 0.16
215 0.15
216 0.14
217 0.14
218 0.15
219 0.19
220 0.19
221 0.19
222 0.19
223 0.19
224 0.21
225 0.21
226 0.18
227 0.15
228 0.14
229 0.12
230 0.16
231 0.16
232 0.16
233 0.19
234 0.22
235 0.21
236 0.25
237 0.27
238 0.24
239 0.27
240 0.3
241 0.31
242 0.31
243 0.3
244 0.25
245 0.26
246 0.25
247 0.24
248 0.2
249 0.17
250 0.16
251 0.17
252 0.2
253 0.19
254 0.19
255 0.17
256 0.17
257 0.15
258 0.12
259 0.12
260 0.09
261 0.07
262 0.07
263 0.08
264 0.1
265 0.09
266 0.1
267 0.08
268 0.08
269 0.08
270 0.07
271 0.06
272 0.05
273 0.04
274 0.04
275 0.05
276 0.05
277 0.06
278 0.06
279 0.06
280 0.07
281 0.07
282 0.07
283 0.07
284 0.07
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.04
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.03
300 0.04
301 0.04
302 0.04
303 0.05
304 0.09
305 0.09
306 0.1
307 0.11
308 0.11
309 0.12
310 0.12
311 0.11
312 0.08
313 0.08
314 0.08
315 0.08
316 0.09
317 0.12
318 0.12
319 0.13
320 0.18
321 0.17
322 0.18
323 0.17
324 0.18
325 0.21
326 0.21
327 0.21
328 0.16
329 0.15
330 0.13
331 0.13
332 0.12
333 0.06
334 0.06
335 0.05
336 0.04
337 0.05
338 0.05
339 0.05
340 0.08
341 0.1
342 0.1
343 0.11
344 0.12
345 0.14
346 0.16
347 0.16
348 0.17
349 0.17
350 0.21
351 0.24
352 0.3
353 0.34
354 0.38
355 0.39
356 0.43
357 0.44
358 0.42
359 0.51
360 0.48
361 0.49
362 0.53
363 0.58
364 0.52
365 0.5
366 0.49
367 0.37
368 0.35
369 0.29
370 0.21
371 0.15
372 0.13
373 0.12
374 0.11
375 0.12
376 0.12
377 0.12
378 0.12
379 0.13
380 0.13
381 0.13
382 0.12
383 0.12
384 0.11
385 0.1
386 0.1
387 0.1
388 0.09
389 0.09
390 0.1
391 0.11
392 0.14
393 0.19
394 0.23
395 0.28
396 0.28
397 0.31
398 0.33
399 0.34
400 0.31
401 0.27
402 0.23
403 0.2
404 0.19
405 0.16
406 0.14
407 0.12
408 0.1
409 0.08
410 0.07
411 0.04
412 0.03
413 0.03
414 0.04
415 0.12
416 0.12
417 0.14
418 0.15
419 0.15
420 0.24
421 0.27
422 0.3
423 0.29
424 0.35
425 0.43
426 0.52
427 0.54
428 0.48
429 0.47
430 0.49
431 0.46
432 0.47
433 0.47
434 0.46
435 0.51
436 0.52
437 0.52
438 0.46
439 0.45
440 0.4
441 0.32
442 0.29
443 0.21
444 0.18
445 0.17
446 0.18
447 0.17
448 0.17
449 0.21
450 0.19
451 0.22
452 0.25
453 0.27
454 0.27
455 0.29
456 0.34
457 0.36
458 0.37
459 0.34
460 0.31
461 0.35
462 0.33
463 0.3
464 0.29
465 0.25
466 0.25
467 0.27
468 0.28
469 0.23
470 0.26
471 0.3
472 0.27
473 0.3
474 0.27
475 0.26
476 0.3
477 0.33
478 0.37
479 0.42
480 0.43
481 0.43
482 0.53
483 0.54
484 0.52
485 0.58
486 0.54
487 0.5
488 0.47
489 0.46
490 0.36
491 0.35
492 0.36
493 0.31
494 0.3
495 0.25
496 0.23
497 0.19
498 0.19
499 0.18
500 0.13
501 0.1
502 0.08
503 0.08
504 0.07
505 0.07
506 0.07
507 0.08
508 0.09
509 0.1
510 0.11
511 0.11
512 0.13
513 0.12
514 0.12
515 0.13
516 0.11
517 0.1
518 0.09
519 0.09
520 0.07
521 0.07
522 0.08
523 0.07
524 0.07
525 0.08
526 0.08
527 0.08
528 0.08
529 0.09
530 0.09
531 0.09
532 0.1
533 0.09
534 0.1
535 0.1
536 0.1
537 0.09
538 0.08
539 0.09
540 0.09