Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DNI3

Protein Details
Accession A0A094DNI3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-43LQAANEQKKRRERKQVASEGSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_mito 11.833, mito 7, mito_nucl 6.333
Family & Domain DBs
Amino Acid Sequences YLVKEVEMIMHSAVLLKAEVKALQAANEQKKRRERKQVASEGSQAADLGKAKESAHSLKVLFDLVLAINSLSPNTEYWTSHNRFIHGLGIVAAKDLNGRNAGTDPMGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.09
6 0.09
7 0.09
8 0.12
9 0.11
10 0.12
11 0.17
12 0.24
13 0.32
14 0.4
15 0.43
16 0.48
17 0.57
18 0.65
19 0.69
20 0.72
21 0.72
22 0.74
23 0.81
24 0.83
25 0.78
26 0.72
27 0.67
28 0.56
29 0.47
30 0.36
31 0.26
32 0.16
33 0.13
34 0.1
35 0.07
36 0.07
37 0.08
38 0.08
39 0.1
40 0.12
41 0.13
42 0.13
43 0.14
44 0.14
45 0.13
46 0.14
47 0.12
48 0.1
49 0.08
50 0.07
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.08
62 0.1
63 0.11
64 0.15
65 0.24
66 0.27
67 0.33
68 0.34
69 0.33
70 0.32
71 0.32
72 0.31
73 0.22
74 0.2
75 0.14
76 0.14
77 0.13
78 0.12
79 0.11
80 0.07
81 0.1
82 0.11
83 0.13
84 0.13
85 0.14
86 0.15
87 0.17
88 0.18
89 0.16