Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CN51

Protein Details
Accession A0A094CN51   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
538-560HEERVRLRERERRDWERERERADBasic
NLS Segment(s)
PositionSequence
227-251AEHPRRQKLNRAAQAPKPRDPPQRR
518-556GREKYRREEFGRARERRSVSHEERVRLRERERRDWERER
Subcellular Location(s) nucl 18, cyto 4, pero 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MAQPQDAAAYYGDLLDSDKKPSRVMVALLTGIAKYIVKNLGDKDTKCLTPPKLAAFYKAVGGNYDSVFIDLPNPQISFIYQSIGCQHTLQPTEDDFHAPSIPALTTRGFVRWQTIEILLDPSGHVPFLQRAVHDFPILNPETCERFPADLPASCLPQEPDAAIEKWHNKCAEKLRRDSAADERPRSQPNHTPDSRHQSPYVKTSHTHPTTAPPRDAPRGADNFNPKAEHPRRQKLNRAAQAPKPRDPPQRRAATPPLEYEDARGRRRSVPKDYYRNIPADSRPSKYPFDVPQEGLRPHSGGPGGRHHSHPRQGRERSSSSSSWSSSSESVTTDPPTSPLYTARRASKSKDQPQPQPQPQQQGNPGKSRRGPKPTTIPFVGRYSASSSPHPDPVAAAASAAAAAAAGLGGLQNEKLRQDHRNRGLSMPNFRHAAGGGPQIATYKIAVDPPPPSSGAGPFTPSYPPNAWRSESRGGGANVRWRDLVDIDIPLGAWVKEPPVAPDAPPAVGGGGGMGEKVGREKYRREEFGRARERRSVSHEERVRLRERERRDWERERERADSETDARLDRRFGGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.16
4 0.22
5 0.28
6 0.29
7 0.31
8 0.32
9 0.35
10 0.32
11 0.33
12 0.3
13 0.27
14 0.27
15 0.26
16 0.25
17 0.19
18 0.16
19 0.15
20 0.11
21 0.08
22 0.12
23 0.16
24 0.17
25 0.21
26 0.24
27 0.33
28 0.39
29 0.39
30 0.41
31 0.43
32 0.42
33 0.42
34 0.47
35 0.41
36 0.43
37 0.47
38 0.47
39 0.5
40 0.5
41 0.51
42 0.47
43 0.44
44 0.39
45 0.38
46 0.31
47 0.24
48 0.25
49 0.23
50 0.2
51 0.2
52 0.16
53 0.14
54 0.14
55 0.12
56 0.13
57 0.12
58 0.14
59 0.15
60 0.15
61 0.15
62 0.15
63 0.16
64 0.18
65 0.17
66 0.18
67 0.15
68 0.16
69 0.2
70 0.22
71 0.22
72 0.18
73 0.2
74 0.23
75 0.26
76 0.27
77 0.25
78 0.25
79 0.27
80 0.27
81 0.27
82 0.21
83 0.2
84 0.19
85 0.16
86 0.15
87 0.13
88 0.12
89 0.11
90 0.12
91 0.11
92 0.12
93 0.13
94 0.15
95 0.16
96 0.16
97 0.21
98 0.2
99 0.21
100 0.22
101 0.22
102 0.2
103 0.19
104 0.21
105 0.16
106 0.14
107 0.13
108 0.12
109 0.11
110 0.1
111 0.09
112 0.08
113 0.1
114 0.14
115 0.15
116 0.14
117 0.18
118 0.23
119 0.24
120 0.24
121 0.22
122 0.19
123 0.25
124 0.27
125 0.23
126 0.19
127 0.2
128 0.24
129 0.24
130 0.25
131 0.19
132 0.19
133 0.19
134 0.24
135 0.25
136 0.22
137 0.26
138 0.26
139 0.26
140 0.24
141 0.25
142 0.2
143 0.18
144 0.17
145 0.13
146 0.13
147 0.15
148 0.15
149 0.15
150 0.19
151 0.25
152 0.27
153 0.31
154 0.32
155 0.3
156 0.36
157 0.45
158 0.51
159 0.51
160 0.55
161 0.55
162 0.57
163 0.58
164 0.55
165 0.53
166 0.52
167 0.51
168 0.48
169 0.46
170 0.46
171 0.49
172 0.48
173 0.45
174 0.43
175 0.43
176 0.49
177 0.47
178 0.49
179 0.51
180 0.58
181 0.58
182 0.53
183 0.5
184 0.46
185 0.47
186 0.47
187 0.44
188 0.37
189 0.33
190 0.34
191 0.41
192 0.37
193 0.36
194 0.31
195 0.36
196 0.42
197 0.45
198 0.43
199 0.36
200 0.38
201 0.41
202 0.42
203 0.36
204 0.33
205 0.34
206 0.34
207 0.35
208 0.37
209 0.34
210 0.35
211 0.33
212 0.27
213 0.33
214 0.37
215 0.41
216 0.44
217 0.51
218 0.59
219 0.64
220 0.73
221 0.72
222 0.77
223 0.75
224 0.72
225 0.68
226 0.65
227 0.7
228 0.65
229 0.6
230 0.56
231 0.57
232 0.61
233 0.63
234 0.64
235 0.63
236 0.66
237 0.62
238 0.63
239 0.62
240 0.57
241 0.52
242 0.46
243 0.41
244 0.34
245 0.32
246 0.28
247 0.29
248 0.29
249 0.3
250 0.3
251 0.29
252 0.34
253 0.43
254 0.46
255 0.47
256 0.51
257 0.58
258 0.65
259 0.65
260 0.64
261 0.59
262 0.55
263 0.47
264 0.4
265 0.33
266 0.33
267 0.34
268 0.3
269 0.3
270 0.32
271 0.32
272 0.3
273 0.33
274 0.28
275 0.33
276 0.33
277 0.31
278 0.31
279 0.33
280 0.32
281 0.29
282 0.25
283 0.19
284 0.16
285 0.17
286 0.14
287 0.12
288 0.14
289 0.2
290 0.24
291 0.24
292 0.28
293 0.32
294 0.36
295 0.42
296 0.46
297 0.47
298 0.52
299 0.55
300 0.58
301 0.58
302 0.56
303 0.53
304 0.51
305 0.44
306 0.39
307 0.37
308 0.32
309 0.27
310 0.25
311 0.22
312 0.18
313 0.18
314 0.15
315 0.13
316 0.13
317 0.13
318 0.14
319 0.13
320 0.12
321 0.12
322 0.13
323 0.13
324 0.13
325 0.17
326 0.2
327 0.24
328 0.28
329 0.32
330 0.37
331 0.38
332 0.43
333 0.47
334 0.54
335 0.58
336 0.63
337 0.63
338 0.67
339 0.75
340 0.8
341 0.77
342 0.76
343 0.7
344 0.7
345 0.66
346 0.62
347 0.61
348 0.6
349 0.56
350 0.56
351 0.55
352 0.52
353 0.54
354 0.57
355 0.56
356 0.56
357 0.56
358 0.54
359 0.62
360 0.62
361 0.63
362 0.58
363 0.53
364 0.47
365 0.45
366 0.4
367 0.3
368 0.25
369 0.23
370 0.24
371 0.24
372 0.23
373 0.25
374 0.26
375 0.29
376 0.28
377 0.23
378 0.2
379 0.2
380 0.19
381 0.14
382 0.11
383 0.08
384 0.08
385 0.07
386 0.07
387 0.04
388 0.02
389 0.02
390 0.02
391 0.02
392 0.02
393 0.02
394 0.02
395 0.02
396 0.03
397 0.04
398 0.05
399 0.06
400 0.08
401 0.11
402 0.15
403 0.23
404 0.32
405 0.42
406 0.49
407 0.56
408 0.57
409 0.57
410 0.62
411 0.59
412 0.6
413 0.54
414 0.49
415 0.43
416 0.41
417 0.38
418 0.3
419 0.28
420 0.21
421 0.2
422 0.18
423 0.16
424 0.16
425 0.16
426 0.17
427 0.14
428 0.11
429 0.09
430 0.09
431 0.12
432 0.13
433 0.15
434 0.17
435 0.18
436 0.2
437 0.2
438 0.2
439 0.18
440 0.2
441 0.2
442 0.19
443 0.19
444 0.18
445 0.18
446 0.21
447 0.2
448 0.23
449 0.23
450 0.26
451 0.28
452 0.32
453 0.34
454 0.34
455 0.4
456 0.41
457 0.39
458 0.37
459 0.37
460 0.35
461 0.37
462 0.37
463 0.38
464 0.33
465 0.33
466 0.32
467 0.26
468 0.27
469 0.23
470 0.22
471 0.16
472 0.15
473 0.14
474 0.13
475 0.13
476 0.11
477 0.12
478 0.09
479 0.08
480 0.08
481 0.09
482 0.12
483 0.12
484 0.15
485 0.17
486 0.19
487 0.18
488 0.24
489 0.24
490 0.21
491 0.21
492 0.19
493 0.15
494 0.13
495 0.12
496 0.07
497 0.05
498 0.05
499 0.04
500 0.04
501 0.04
502 0.05
503 0.08
504 0.13
505 0.18
506 0.22
507 0.3
508 0.39
509 0.49
510 0.57
511 0.59
512 0.65
513 0.68
514 0.75
515 0.79
516 0.75
517 0.7
518 0.71
519 0.69
520 0.64
521 0.63
522 0.62
523 0.58
524 0.63
525 0.65
526 0.63
527 0.67
528 0.69
529 0.68
530 0.64
531 0.66
532 0.64
533 0.66
534 0.7
535 0.73
536 0.75
537 0.77
538 0.81
539 0.83
540 0.85
541 0.84
542 0.79
543 0.74
544 0.68
545 0.62
546 0.55
547 0.51
548 0.44
549 0.42
550 0.39
551 0.37
552 0.36
553 0.35
554 0.34
555 0.33