Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094C6M2

Protein Details
Accession A0A094C6M2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-85EASQHSDYYRRRPKRRCRKRIARRSEEARRVVBasic
NLS Segment(s)
PositionSequence
63-80RRRPKRRCRKRIARRSEE
Subcellular Location(s) mito 9, cyto 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MAGRSWCETAQVIGALFPTIVAHGKWDRPLLSEPQVDRPGVPVELRVARHGRSEASQHSDYYRRRPKRRCRKRIARRSEEARRVVGGTASDWGAVLSGWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.07
5 0.06
6 0.06
7 0.07
8 0.06
9 0.1
10 0.13
11 0.15
12 0.18
13 0.2
14 0.2
15 0.22
16 0.25
17 0.25
18 0.28
19 0.3
20 0.29
21 0.34
22 0.36
23 0.32
24 0.29
25 0.27
26 0.23
27 0.19
28 0.18
29 0.11
30 0.12
31 0.15
32 0.16
33 0.17
34 0.17
35 0.17
36 0.18
37 0.18
38 0.16
39 0.14
40 0.17
41 0.17
42 0.21
43 0.22
44 0.21
45 0.23
46 0.29
47 0.3
48 0.37
49 0.45
50 0.48
51 0.57
52 0.67
53 0.76
54 0.8
55 0.9
56 0.9
57 0.91
58 0.93
59 0.95
60 0.96
61 0.95
62 0.93
63 0.91
64 0.89
65 0.88
66 0.85
67 0.77
68 0.68
69 0.59
70 0.51
71 0.42
72 0.34
73 0.25
74 0.17
75 0.15
76 0.14
77 0.12
78 0.1
79 0.1
80 0.08