Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094DZ33

Protein Details
Accession A0A094DZ33   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-62RPSKSSTTYYQKRRKVPRIHHTSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.333, cyto 9, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR021278  ATP19  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF11022  ATP19  
Amino Acid Sequences MTLSYSHIIGGEAAARGSDRGNEIAKSSGCAVGSESQRRPSKSSTTYYQKRRKVPRIHHTSLRINQANTVKMVVMYNIAGRQIASHWLSIATLSITFGGAALAMGGKKVEKTTTPPINAKNSDEEKFIKDFLADMDSSEKKAQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.1
6 0.1
7 0.13
8 0.15
9 0.16
10 0.17
11 0.21
12 0.2
13 0.2
14 0.19
15 0.18
16 0.16
17 0.16
18 0.17
19 0.19
20 0.24
21 0.29
22 0.3
23 0.36
24 0.41
25 0.44
26 0.45
27 0.43
28 0.46
29 0.44
30 0.47
31 0.47
32 0.52
33 0.59
34 0.66
35 0.71
36 0.7
37 0.74
38 0.79
39 0.81
40 0.8
41 0.82
42 0.82
43 0.82
44 0.8
45 0.77
46 0.73
47 0.71
48 0.66
49 0.64
50 0.55
51 0.45
52 0.45
53 0.41
54 0.36
55 0.28
56 0.24
57 0.15
58 0.13
59 0.13
60 0.09
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.06
96 0.08
97 0.1
98 0.16
99 0.26
100 0.33
101 0.38
102 0.43
103 0.47
104 0.54
105 0.55
106 0.51
107 0.5
108 0.48
109 0.44
110 0.43
111 0.4
112 0.36
113 0.35
114 0.33
115 0.25
116 0.2
117 0.19
118 0.17
119 0.18
120 0.14
121 0.13
122 0.19
123 0.2
124 0.23
125 0.27