Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GJP2

Protein Details
Accession C5GJP2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MMTTQPTCRRKGKFRQPRRVQVHDEEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MMTTQPTCRRKGKFRQPRRVQVHDEEGWTHITTTNRTASNKLCVLSPIKDLLVPAESPDGLTFQKLKKQFEWHKRCWEESQSWQALKAALDNELLTGPASKVDNCVCVGLGSPSGFLRGGWVDRRAVSLYQLAALVTMLEYFARKDTPSISIKDCSAQDPVFNALDKQLLEYAGIRVVQHPAAFTLINERTFLYAPGAERVHILDMLSSNPALFFGGTLDDENLVRLPDDNEQVLLRFLKTRRSMLLPPFDPNIHSFWKSSLFWRPEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.92
4 0.94
5 0.93
6 0.9
7 0.86
8 0.82
9 0.79
10 0.71
11 0.63
12 0.53
13 0.45
14 0.39
15 0.32
16 0.25
17 0.21
18 0.2
19 0.2
20 0.23
21 0.27
22 0.29
23 0.3
24 0.33
25 0.33
26 0.38
27 0.38
28 0.35
29 0.3
30 0.29
31 0.31
32 0.3
33 0.29
34 0.24
35 0.21
36 0.21
37 0.21
38 0.19
39 0.17
40 0.14
41 0.13
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.1
48 0.12
49 0.15
50 0.15
51 0.22
52 0.27
53 0.31
54 0.33
55 0.44
56 0.52
57 0.59
58 0.67
59 0.67
60 0.73
61 0.73
62 0.72
63 0.67
64 0.63
65 0.57
66 0.54
67 0.56
68 0.5
69 0.46
70 0.43
71 0.38
72 0.33
73 0.28
74 0.24
75 0.15
76 0.11
77 0.12
78 0.11
79 0.11
80 0.09
81 0.09
82 0.07
83 0.07
84 0.05
85 0.07
86 0.08
87 0.07
88 0.1
89 0.1
90 0.12
91 0.12
92 0.12
93 0.1
94 0.1
95 0.1
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.09
107 0.11
108 0.13
109 0.13
110 0.13
111 0.15
112 0.14
113 0.14
114 0.13
115 0.12
116 0.11
117 0.1
118 0.1
119 0.08
120 0.07
121 0.06
122 0.05
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.05
131 0.05
132 0.06
133 0.07
134 0.13
135 0.16
136 0.18
137 0.2
138 0.2
139 0.21
140 0.23
141 0.22
142 0.19
143 0.19
144 0.17
145 0.15
146 0.15
147 0.16
148 0.14
149 0.14
150 0.12
151 0.1
152 0.11
153 0.11
154 0.1
155 0.09
156 0.08
157 0.08
158 0.09
159 0.09
160 0.08
161 0.09
162 0.08
163 0.08
164 0.1
165 0.11
166 0.1
167 0.1
168 0.09
169 0.1
170 0.1
171 0.09
172 0.14
173 0.16
174 0.16
175 0.17
176 0.17
177 0.17
178 0.17
179 0.18
180 0.13
181 0.12
182 0.12
183 0.16
184 0.16
185 0.15
186 0.15
187 0.15
188 0.15
189 0.13
190 0.12
191 0.09
192 0.09
193 0.1
194 0.1
195 0.09
196 0.08
197 0.07
198 0.08
199 0.07
200 0.06
201 0.05
202 0.05
203 0.06
204 0.07
205 0.08
206 0.08
207 0.09
208 0.09
209 0.1
210 0.1
211 0.08
212 0.08
213 0.08
214 0.1
215 0.13
216 0.16
217 0.16
218 0.16
219 0.17
220 0.17
221 0.19
222 0.18
223 0.15
224 0.18
225 0.19
226 0.27
227 0.31
228 0.34
229 0.36
230 0.42
231 0.48
232 0.5
233 0.59
234 0.52
235 0.51
236 0.51
237 0.48
238 0.43
239 0.38
240 0.35
241 0.3
242 0.3
243 0.27
244 0.25
245 0.31
246 0.3
247 0.33
248 0.39
249 0.37