Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179U2C4

Protein Details
Accession A0A179U2C4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-39IRNPLREKQSRVYKKVKRMYKKLKKHMRLQYKKPAYACHydrophilic
NLS Segment(s)
PositionSequence
11-29SRVYKKVKRMYKKLKKHMR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MIRNPLREKQSRVYKKVKRMYKKLKKHMRLQYKKPAYACNLIRRAEDKLNTDTLASRRDITSLQGMTTTITAVREAGENVTIRAVLPRLIDTVFTFNLAFLTVTEAAAAPQRCLLLTRKHQNKPLIISQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.84
4 0.84
5 0.83
6 0.84
7 0.88
8 0.88
9 0.9
10 0.91
11 0.92
12 0.91
13 0.9
14 0.9
15 0.9
16 0.89
17 0.87
18 0.87
19 0.84
20 0.81
21 0.73
22 0.68
23 0.61
24 0.6
25 0.57
26 0.55
27 0.52
28 0.48
29 0.47
30 0.44
31 0.43
32 0.4
33 0.37
34 0.32
35 0.28
36 0.29
37 0.27
38 0.26
39 0.23
40 0.2
41 0.2
42 0.17
43 0.15
44 0.13
45 0.14
46 0.14
47 0.13
48 0.15
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.1
55 0.09
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.08
65 0.07
66 0.08
67 0.08
68 0.07
69 0.07
70 0.08
71 0.08
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1
79 0.14
80 0.12
81 0.13
82 0.12
83 0.11
84 0.11
85 0.1
86 0.09
87 0.06
88 0.1
89 0.09
90 0.09
91 0.1
92 0.09
93 0.09
94 0.15
95 0.15
96 0.11
97 0.12
98 0.13
99 0.13
100 0.15
101 0.2
102 0.25
103 0.35
104 0.45
105 0.54
106 0.61
107 0.68
108 0.73
109 0.75
110 0.72