Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U924

Protein Details
Accession A0A179U924    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-84MIIISDEKKEKKKKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
70-84KKEKKKKKKKKKNEK
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
Amino Acid Sequences MHFIIQNIEKTALLSEHVNLLTTEMEPETADQKMQDFEIQINLAEREQQKFFSEKTAERDFEMIIISDEKKEKKKKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.13
4 0.13
5 0.13
6 0.12
7 0.12
8 0.11
9 0.1
10 0.11
11 0.07
12 0.08
13 0.07
14 0.08
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.07
31 0.11
32 0.11
33 0.13
34 0.13
35 0.14
36 0.15
37 0.17
38 0.18
39 0.2
40 0.22
41 0.22
42 0.28
43 0.33
44 0.32
45 0.31
46 0.32
47 0.25
48 0.23
49 0.2
50 0.14
51 0.1
52 0.11
53 0.11
54 0.13
55 0.18
56 0.22
57 0.31
58 0.41
59 0.51
60 0.6
61 0.71
62 0.79
63 0.86
64 0.93