Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GE65

Protein Details
Accession C5GE65    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
314-334SPTPGNSKPSKPNRPGRPGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MHFISKLSIAATVTAAALTQAQPLKRFGYRDDSIRSNDGNANAAGQYPSGPPPAMSILPVSSDVDPIDTPYSSPTSTREVTPSYGPPTVSVGYSASLPSDYSIPTSLATPTYGPPSVTDAFPTGNPTDDSVPTDVTPTYGPPSVTGAFPTGNPTDDSVPTDVTPTYGPPSVTAEFPTSIPADYSPPASSDSGPITVTVRPLPVSSASGVNPIQTSSTSDSQATPTYGPPSVTSGFPTIPADNPGPISSKTATVTYTLGTGTETVVVTRTVTIGVPPQHQKPTPPPDAGVDPISDSTTTLSTTSTTTTTITLEPSPTPGNSKPSKPNRPGRPGGSPCKPVVIVTVTEEAVTVTATPTAVDPTFDNPKPTEVVTPHPYPTTPSDDDDDVTSALPSTSSVSVPVKVPLPPYPTGTTVRAKPTTSSGFLTRVHPIPTGGYYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.09
5 0.08
6 0.13
7 0.16
8 0.18
9 0.21
10 0.24
11 0.29
12 0.31
13 0.33
14 0.32
15 0.37
16 0.39
17 0.43
18 0.46
19 0.47
20 0.47
21 0.49
22 0.45
23 0.4
24 0.4
25 0.35
26 0.32
27 0.27
28 0.24
29 0.2
30 0.2
31 0.16
32 0.13
33 0.13
34 0.12
35 0.14
36 0.15
37 0.15
38 0.14
39 0.16
40 0.2
41 0.19
42 0.17
43 0.16
44 0.15
45 0.16
46 0.17
47 0.17
48 0.13
49 0.14
50 0.13
51 0.13
52 0.13
53 0.14
54 0.14
55 0.12
56 0.12
57 0.14
58 0.17
59 0.15
60 0.17
61 0.17
62 0.21
63 0.23
64 0.24
65 0.25
66 0.25
67 0.27
68 0.3
69 0.31
70 0.3
71 0.31
72 0.29
73 0.26
74 0.27
75 0.25
76 0.21
77 0.18
78 0.14
79 0.13
80 0.13
81 0.12
82 0.09
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.12
94 0.11
95 0.12
96 0.11
97 0.12
98 0.15
99 0.16
100 0.15
101 0.15
102 0.2
103 0.2
104 0.19
105 0.19
106 0.16
107 0.16
108 0.16
109 0.19
110 0.14
111 0.14
112 0.15
113 0.15
114 0.16
115 0.16
116 0.18
117 0.15
118 0.16
119 0.14
120 0.15
121 0.13
122 0.12
123 0.11
124 0.1
125 0.12
126 0.13
127 0.13
128 0.12
129 0.16
130 0.16
131 0.15
132 0.15
133 0.14
134 0.12
135 0.13
136 0.16
137 0.13
138 0.13
139 0.13
140 0.14
141 0.15
142 0.16
143 0.18
144 0.15
145 0.15
146 0.14
147 0.15
148 0.13
149 0.12
150 0.11
151 0.1
152 0.12
153 0.13
154 0.13
155 0.12
156 0.17
157 0.16
158 0.17
159 0.17
160 0.16
161 0.15
162 0.15
163 0.16
164 0.12
165 0.11
166 0.1
167 0.1
168 0.1
169 0.1
170 0.12
171 0.1
172 0.1
173 0.12
174 0.13
175 0.13
176 0.12
177 0.13
178 0.12
179 0.12
180 0.12
181 0.11
182 0.11
183 0.12
184 0.1
185 0.1
186 0.09
187 0.09
188 0.1
189 0.09
190 0.09
191 0.09
192 0.1
193 0.1
194 0.12
195 0.12
196 0.12
197 0.11
198 0.1
199 0.09
200 0.08
201 0.1
202 0.11
203 0.13
204 0.13
205 0.14
206 0.14
207 0.15
208 0.16
209 0.14
210 0.11
211 0.11
212 0.12
213 0.12
214 0.12
215 0.11
216 0.14
217 0.14
218 0.13
219 0.14
220 0.13
221 0.13
222 0.13
223 0.14
224 0.11
225 0.11
226 0.13
227 0.12
228 0.11
229 0.12
230 0.12
231 0.12
232 0.12
233 0.15
234 0.13
235 0.14
236 0.14
237 0.14
238 0.14
239 0.13
240 0.13
241 0.1
242 0.1
243 0.08
244 0.08
245 0.07
246 0.07
247 0.06
248 0.06
249 0.06
250 0.05
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.1
260 0.12
261 0.17
262 0.2
263 0.24
264 0.28
265 0.29
266 0.32
267 0.37
268 0.43
269 0.43
270 0.41
271 0.39
272 0.36
273 0.38
274 0.36
275 0.28
276 0.2
277 0.15
278 0.14
279 0.14
280 0.11
281 0.09
282 0.08
283 0.08
284 0.08
285 0.08
286 0.07
287 0.08
288 0.08
289 0.1
290 0.09
291 0.1
292 0.1
293 0.1
294 0.12
295 0.11
296 0.13
297 0.12
298 0.13
299 0.13
300 0.15
301 0.16
302 0.15
303 0.19
304 0.2
305 0.27
306 0.29
307 0.35
308 0.43
309 0.52
310 0.62
311 0.66
312 0.73
313 0.76
314 0.8
315 0.81
316 0.76
317 0.76
318 0.74
319 0.73
320 0.7
321 0.64
322 0.56
323 0.52
324 0.47
325 0.37
326 0.32
327 0.27
328 0.2
329 0.19
330 0.21
331 0.17
332 0.17
333 0.17
334 0.13
335 0.1
336 0.09
337 0.07
338 0.05
339 0.05
340 0.05
341 0.06
342 0.06
343 0.09
344 0.09
345 0.1
346 0.11
347 0.15
348 0.23
349 0.24
350 0.27
351 0.25
352 0.27
353 0.28
354 0.28
355 0.29
356 0.24
357 0.3
358 0.33
359 0.36
360 0.35
361 0.35
362 0.34
363 0.32
364 0.34
365 0.35
366 0.31
367 0.3
368 0.32
369 0.32
370 0.33
371 0.31
372 0.27
373 0.2
374 0.17
375 0.15
376 0.11
377 0.1
378 0.09
379 0.08
380 0.09
381 0.1
382 0.1
383 0.14
384 0.16
385 0.18
386 0.19
387 0.22
388 0.21
389 0.21
390 0.25
391 0.27
392 0.3
393 0.3
394 0.34
395 0.35
396 0.37
397 0.39
398 0.41
399 0.42
400 0.42
401 0.48
402 0.47
403 0.45
404 0.43
405 0.46
406 0.47
407 0.44
408 0.43
409 0.38
410 0.38
411 0.39
412 0.4
413 0.39
414 0.36
415 0.35
416 0.32
417 0.3
418 0.29