Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZM41

Protein Details
Accession A0A093ZM41    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-95GDDWLVRQRQKKRRCRVISWGITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 7, E.R. 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRSKAPRGHRPSPLAQEVHLRPVSELPNLAVADPIFWKRFSAAIHEAEGSDIENGRARSTSDSTGYTMDKTGDDWLVRQRQKKRRCRVISWGITLSIVLVIIAVAVVAWYFTAGPGKAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.62
3 0.54
4 0.54
5 0.47
6 0.48
7 0.42
8 0.34
9 0.28
10 0.31
11 0.32
12 0.24
13 0.23
14 0.16
15 0.19
16 0.19
17 0.18
18 0.15
19 0.12
20 0.12
21 0.13
22 0.15
23 0.12
24 0.12
25 0.12
26 0.12
27 0.15
28 0.14
29 0.19
30 0.2
31 0.21
32 0.22
33 0.22
34 0.21
35 0.18
36 0.18
37 0.12
38 0.08
39 0.06
40 0.05
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.11
47 0.13
48 0.14
49 0.13
50 0.14
51 0.14
52 0.16
53 0.16
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.16
64 0.24
65 0.28
66 0.35
67 0.44
68 0.52
69 0.62
70 0.71
71 0.76
72 0.78
73 0.82
74 0.81
75 0.82
76 0.83
77 0.8
78 0.74
79 0.65
80 0.54
81 0.47
82 0.4
83 0.29
84 0.19
85 0.11
86 0.06
87 0.04
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.04
100 0.08
101 0.09