Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AV16

Protein Details
Accession A0A094AV16    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGSSARKKAEKKKDFKKPKLRVGKTKAKPDNFTBasic
NLS Segment(s)
PositionSequence
5-28ARKKAEKKKDFKKPKLRVGKTKAK
Subcellular Location(s) nucl 16, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR024679  Ipi1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0097344  C:Rix1 complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF12333  Ipi1_N  
Amino Acid Sequences MGSSARKKAEKKKDFKKPKLRVGKTKAKPDNFTDTSFKSRSITVNQQSLTTSAPASDIQFDHYLSLASSSKSDAQRRDALSYLITQVSSQPVNAPIPVSPTTILQKLLPLILDGSQSVRTQLLKFLRLLPAKDVGDRAEFALLYIRAGMTHLAVEIRNDALSVLEWLVETAPEDVVSCPGGWVKTLKAFMSMMGWAVSVGSTKWSAAAKVTFGKGGKSFPRQITVLAQFLKAGLSRMVTEDSFQRGSCFPLWDADIHVISAQASPFAHLNLFGPGRDEEGEMYTERESRQRVFHLRFQTSVDKGIESAKKEGGEMGRAGAILGKVVTESMDDYDEMGNPADRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.94
3 0.94
4 0.93
5 0.93
6 0.94
7 0.93
8 0.92
9 0.91
10 0.91
11 0.88
12 0.89
13 0.88
14 0.84
15 0.8
16 0.75
17 0.75
18 0.67
19 0.63
20 0.58
21 0.53
22 0.53
23 0.49
24 0.44
25 0.35
26 0.35
27 0.35
28 0.37
29 0.42
30 0.41
31 0.47
32 0.46
33 0.45
34 0.43
35 0.4
36 0.34
37 0.25
38 0.18
39 0.11
40 0.13
41 0.12
42 0.13
43 0.15
44 0.13
45 0.16
46 0.17
47 0.17
48 0.16
49 0.15
50 0.14
51 0.11
52 0.14
53 0.11
54 0.11
55 0.11
56 0.13
57 0.19
58 0.25
59 0.31
60 0.32
61 0.36
62 0.43
63 0.44
64 0.45
65 0.4
66 0.35
67 0.3
68 0.28
69 0.24
70 0.18
71 0.15
72 0.12
73 0.13
74 0.15
75 0.14
76 0.12
77 0.12
78 0.14
79 0.15
80 0.15
81 0.14
82 0.11
83 0.16
84 0.17
85 0.16
86 0.14
87 0.15
88 0.18
89 0.19
90 0.19
91 0.15
92 0.15
93 0.14
94 0.14
95 0.12
96 0.1
97 0.09
98 0.09
99 0.09
100 0.08
101 0.09
102 0.1
103 0.1
104 0.11
105 0.11
106 0.12
107 0.12
108 0.18
109 0.2
110 0.2
111 0.21
112 0.23
113 0.29
114 0.3
115 0.3
116 0.26
117 0.28
118 0.27
119 0.27
120 0.25
121 0.19
122 0.18
123 0.17
124 0.15
125 0.11
126 0.1
127 0.09
128 0.11
129 0.1
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.05
165 0.05
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.1
172 0.12
173 0.12
174 0.13
175 0.13
176 0.12
177 0.12
178 0.12
179 0.08
180 0.07
181 0.07
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.05
188 0.05
189 0.05
190 0.07
191 0.08
192 0.08
193 0.1
194 0.1
195 0.11
196 0.13
197 0.14
198 0.15
199 0.15
200 0.17
201 0.16
202 0.19
203 0.23
204 0.26
205 0.31
206 0.3
207 0.34
208 0.32
209 0.32
210 0.34
211 0.32
212 0.3
213 0.25
214 0.24
215 0.2
216 0.19
217 0.19
218 0.13
219 0.11
220 0.08
221 0.08
222 0.08
223 0.1
224 0.12
225 0.11
226 0.12
227 0.13
228 0.16
229 0.17
230 0.16
231 0.17
232 0.15
233 0.19
234 0.2
235 0.19
236 0.16
237 0.17
238 0.18
239 0.17
240 0.18
241 0.17
242 0.15
243 0.13
244 0.12
245 0.1
246 0.1
247 0.1
248 0.08
249 0.08
250 0.07
251 0.08
252 0.09
253 0.09
254 0.09
255 0.08
256 0.09
257 0.13
258 0.14
259 0.12
260 0.14
261 0.14
262 0.16
263 0.17
264 0.16
265 0.13
266 0.14
267 0.15
268 0.13
269 0.15
270 0.13
271 0.15
272 0.15
273 0.19
274 0.21
275 0.23
276 0.27
277 0.33
278 0.42
279 0.45
280 0.52
281 0.56
282 0.56
283 0.54
284 0.54
285 0.54
286 0.46
287 0.46
288 0.39
289 0.3
290 0.28
291 0.34
292 0.34
293 0.3
294 0.31
295 0.29
296 0.28
297 0.28
298 0.32
299 0.27
300 0.26
301 0.23
302 0.21
303 0.19
304 0.18
305 0.18
306 0.15
307 0.13
308 0.1
309 0.09
310 0.08
311 0.07
312 0.07
313 0.08
314 0.06
315 0.08
316 0.09
317 0.1
318 0.1
319 0.12
320 0.13
321 0.13
322 0.14
323 0.14