Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BVV7

Protein Details
Accession A0A094BVV7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-80LVILEGARRRRRRPKRRHGHGIDNVGGBasic
NLS Segment(s)
PositionSequence
60-72ARRRRRRPKRRHG
Subcellular Location(s) nucl 16cyto_nucl 16, cyto 8
Family & Domain DBs
Amino Acid Sequences MDEGHPCQYGHDTQEGDGILGEKLLSPDIAPCHAEQYDGYGEHGAPPAHDHRCLVILEGARRRRRRPKRRHGHGIDNVGGDICPPASTGRQAGGEGGRRRIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.2
4 0.17
5 0.15
6 0.1
7 0.09
8 0.08
9 0.06
10 0.06
11 0.06
12 0.06
13 0.05
14 0.08
15 0.09
16 0.11
17 0.11
18 0.11
19 0.14
20 0.14
21 0.14
22 0.12
23 0.14
24 0.14
25 0.13
26 0.14
27 0.11
28 0.11
29 0.11
30 0.14
31 0.1
32 0.08
33 0.1
34 0.14
35 0.15
36 0.15
37 0.14
38 0.13
39 0.15
40 0.15
41 0.13
42 0.12
43 0.12
44 0.16
45 0.23
46 0.3
47 0.36
48 0.4
49 0.47
50 0.56
51 0.65
52 0.72
53 0.77
54 0.81
55 0.84
56 0.91
57 0.94
58 0.91
59 0.9
60 0.87
61 0.82
62 0.73
63 0.62
64 0.52
65 0.41
66 0.33
67 0.22
68 0.15
69 0.08
70 0.05
71 0.06
72 0.08
73 0.09
74 0.12
75 0.13
76 0.16
77 0.17
78 0.17
79 0.2
80 0.23
81 0.3
82 0.32