Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B8E7

Protein Details
Accession A0A094B8E7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26TLTFPQTRARRTRRALGKRRLALVRHydrophilic
NLS Segment(s)
PositionSequence
10-31ARRTRRALGKRRLALVRAPLSR
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027057  CAXX_Prtase_1  
IPR001915  Peptidase_M48  
IPR032456  Peptidase_M48_N  
Gene Ontology GO:0016020  C:membrane  
GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0071586  P:CAAX-box protein processing  
Pfam View protein in Pfam  
PF01435  Peptidase_M48  
PF16491  Peptidase_M48_N  
CDD cd07343  M48A_Zmpste24p_like  
Amino Acid Sequences MTLTFPQTRARRTRRALGKRRLALVRAPLSRRGHVGGPADATGLSKLDTKKKVLYRDSTLPSIITRLVKMDILQRLAHFLDRPLFPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQFSFVSSLYGQIQNTAFIYYDILPKLWGLTGSWLLQYAPARFSGEISHSIVFVLTFIIIQQVLSLPTSIYSTFVLEEKFGFNKQTPKLFVTDILKSQMLAFILAPPILAGFLKIVQKTGNQFFYYLWLFGAALQVFMITVYPITILPLFNKLSPLDPGALKTGVEGLAARLNFPLKELYVIDGSKRSAHSNAYFFGLPWKKHIVIYDTLIEKSETEEVVAVLAHELGHWSLGHTTRLFAISQVHFFYIFSLFSVFINNKSLYRSFGFHTSMPIIIGFILFSDALAPMDTVIKLLMNILSRRYEFQADEFAQKLGYSTELAKSLIKLQIQNLSTMDADWMYATYHFSHPILSERLGALGWHGDKSGESVVDEKSESVAKASGRDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.86
4 0.86
5 0.88
6 0.84
7 0.85
8 0.8
9 0.72
10 0.66
11 0.65
12 0.63
13 0.6
14 0.57
15 0.58
16 0.57
17 0.57
18 0.54
19 0.48
20 0.42
21 0.4
22 0.41
23 0.35
24 0.32
25 0.3
26 0.27
27 0.23
28 0.21
29 0.16
30 0.13
31 0.11
32 0.14
33 0.18
34 0.27
35 0.31
36 0.35
37 0.43
38 0.49
39 0.57
40 0.6
41 0.63
42 0.62
43 0.66
44 0.67
45 0.61
46 0.56
47 0.47
48 0.4
49 0.35
50 0.31
51 0.24
52 0.19
53 0.19
54 0.19
55 0.19
56 0.2
57 0.25
58 0.25
59 0.26
60 0.27
61 0.25
62 0.27
63 0.27
64 0.28
65 0.22
66 0.2
67 0.23
68 0.22
69 0.25
70 0.3
71 0.32
72 0.31
73 0.36
74 0.34
75 0.34
76 0.35
77 0.35
78 0.28
79 0.29
80 0.29
81 0.24
82 0.27
83 0.21
84 0.2
85 0.18
86 0.17
87 0.13
88 0.12
89 0.12
90 0.08
91 0.13
92 0.14
93 0.15
94 0.14
95 0.18
96 0.22
97 0.25
98 0.34
99 0.37
100 0.4
101 0.48
102 0.57
103 0.58
104 0.56
105 0.55
106 0.53
107 0.5
108 0.54
109 0.48
110 0.44
111 0.42
112 0.4
113 0.38
114 0.31
115 0.27
116 0.2
117 0.17
118 0.12
119 0.11
120 0.1
121 0.14
122 0.2
123 0.22
124 0.25
125 0.29
126 0.36
127 0.36
128 0.36
129 0.35
130 0.3
131 0.29
132 0.28
133 0.24
134 0.19
135 0.18
136 0.19
137 0.19
138 0.2
139 0.17
140 0.17
141 0.17
142 0.14
143 0.15
144 0.14
145 0.11
146 0.09
147 0.11
148 0.09
149 0.13
150 0.12
151 0.12
152 0.11
153 0.11
154 0.12
155 0.1
156 0.09
157 0.06
158 0.08
159 0.1
160 0.11
161 0.11
162 0.11
163 0.1
164 0.13
165 0.15
166 0.13
167 0.12
168 0.13
169 0.14
170 0.14
171 0.14
172 0.14
173 0.14
174 0.15
175 0.16
176 0.16
177 0.14
178 0.14
179 0.13
180 0.11
181 0.09
182 0.06
183 0.04
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.06
198 0.07
199 0.07
200 0.07
201 0.08
202 0.09
203 0.09
204 0.08
205 0.09
206 0.09
207 0.1
208 0.11
209 0.12
210 0.13
211 0.2
212 0.22
213 0.26
214 0.27
215 0.27
216 0.28
217 0.27
218 0.28
219 0.25
220 0.24
221 0.21
222 0.21
223 0.19
224 0.17
225 0.17
226 0.14
227 0.11
228 0.09
229 0.08
230 0.07
231 0.07
232 0.07
233 0.06
234 0.05
235 0.05
236 0.04
237 0.04
238 0.03
239 0.03
240 0.06
241 0.09
242 0.09
243 0.09
244 0.1
245 0.12
246 0.15
247 0.18
248 0.19
249 0.17
250 0.17
251 0.17
252 0.2
253 0.18
254 0.15
255 0.11
256 0.09
257 0.08
258 0.08
259 0.1
260 0.07
261 0.06
262 0.06
263 0.06
264 0.05
265 0.05
266 0.05
267 0.02
268 0.02
269 0.02
270 0.03
271 0.03
272 0.04
273 0.05
274 0.05
275 0.06
276 0.1
277 0.11
278 0.1
279 0.12
280 0.12
281 0.12
282 0.13
283 0.14
284 0.12
285 0.11
286 0.12
287 0.13
288 0.12
289 0.11
290 0.1
291 0.1
292 0.08
293 0.08
294 0.07
295 0.06
296 0.08
297 0.08
298 0.09
299 0.08
300 0.09
301 0.09
302 0.1
303 0.1
304 0.07
305 0.09
306 0.09
307 0.1
308 0.12
309 0.12
310 0.12
311 0.13
312 0.14
313 0.15
314 0.15
315 0.16
316 0.15
317 0.19
318 0.22
319 0.22
320 0.22
321 0.22
322 0.21
323 0.19
324 0.27
325 0.28
326 0.24
327 0.26
328 0.29
329 0.28
330 0.29
331 0.31
332 0.26
333 0.24
334 0.26
335 0.27
336 0.24
337 0.23
338 0.23
339 0.2
340 0.16
341 0.15
342 0.15
343 0.1
344 0.09
345 0.09
346 0.08
347 0.08
348 0.08
349 0.06
350 0.04
351 0.05
352 0.04
353 0.04
354 0.04
355 0.04
356 0.05
357 0.05
358 0.06
359 0.08
360 0.1
361 0.13
362 0.12
363 0.13
364 0.13
365 0.15
366 0.14
367 0.12
368 0.17
369 0.16
370 0.18
371 0.18
372 0.18
373 0.17
374 0.16
375 0.17
376 0.12
377 0.11
378 0.09
379 0.09
380 0.09
381 0.09
382 0.13
383 0.12
384 0.12
385 0.16
386 0.17
387 0.17
388 0.2
389 0.21
390 0.21
391 0.22
392 0.23
393 0.21
394 0.26
395 0.28
396 0.25
397 0.27
398 0.25
399 0.23
400 0.21
401 0.19
402 0.14
403 0.11
404 0.1
405 0.06
406 0.05
407 0.05
408 0.05
409 0.05
410 0.05
411 0.05
412 0.06
413 0.06
414 0.06
415 0.05
416 0.07
417 0.07
418 0.07
419 0.07
420 0.07
421 0.06
422 0.07
423 0.1
424 0.12
425 0.14
426 0.16
427 0.2
428 0.21
429 0.24
430 0.26
431 0.27
432 0.24
433 0.25
434 0.31
435 0.3
436 0.32
437 0.3
438 0.27
439 0.24
440 0.22
441 0.21
442 0.13
443 0.12
444 0.1
445 0.11
446 0.13
447 0.15
448 0.16
449 0.17
450 0.17
451 0.21
452 0.24
453 0.25
454 0.25
455 0.27
456 0.33
457 0.33
458 0.34
459 0.29
460 0.27
461 0.24
462 0.22
463 0.2
464 0.12
465 0.11
466 0.09
467 0.09
468 0.08
469 0.08
470 0.1
471 0.12
472 0.14
473 0.16
474 0.16
475 0.17
476 0.18
477 0.23
478 0.25
479 0.23
480 0.24
481 0.21
482 0.22
483 0.2
484 0.19
485 0.14
486 0.17
487 0.17
488 0.15
489 0.15
490 0.15
491 0.15
492 0.18
493 0.2
494 0.14
495 0.14
496 0.16
497 0.17
498 0.19
499 0.19
500 0.16
501 0.16
502 0.17
503 0.17
504 0.16
505 0.19
506 0.17
507 0.21