Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GAY4

Protein Details
Accession C5GAY4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-47KVEPQEKKKSPKGRAKKRLQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKSPKGRAKKR
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKSPKGRAKKRLQYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.65
9 0.64
10 0.67
11 0.7
12 0.71
13 0.74
14 0.73
15 0.75
16 0.74
17 0.79
18 0.8
19 0.8
20 0.83
21 0.86
22 0.87
23 0.88
24 0.89
25 0.88
26 0.87
27 0.83
28 0.82
29 0.78
30 0.7
31 0.61
32 0.58
33 0.52
34 0.45
35 0.44
36 0.37
37 0.36
38 0.36
39 0.38
40 0.37
41 0.42
42 0.48