Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5G830

Protein Details
Accession C5G830    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-130LMDTEHRLKARRKRRISNLGLKNDTSHydrophilic
NLS Segment(s)
PositionSequence
113-119KARRKRR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MHTALLTNKLKAAQPTSAHSITQPPSRYPSPPGAVSYPPQPPIRYSSTPPPSPLSPLSTDPIFDAVNGDKSNDVDQQVKLALTELLNSASIKTHQDVRMWVQNKLMDTEHRLKARRKRRISNLGLKNDTSPLSAPLSAPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.38
5 0.36
6 0.33
7 0.35
8 0.33
9 0.37
10 0.34
11 0.3
12 0.35
13 0.37
14 0.39
15 0.37
16 0.4
17 0.38
18 0.37
19 0.38
20 0.35
21 0.34
22 0.33
23 0.34
24 0.3
25 0.3
26 0.31
27 0.28
28 0.27
29 0.3
30 0.35
31 0.33
32 0.34
33 0.39
34 0.44
35 0.45
36 0.45
37 0.43
38 0.37
39 0.37
40 0.35
41 0.28
42 0.24
43 0.24
44 0.24
45 0.2
46 0.2
47 0.17
48 0.17
49 0.13
50 0.1
51 0.1
52 0.08
53 0.11
54 0.1
55 0.1
56 0.09
57 0.09
58 0.11
59 0.11
60 0.12
61 0.11
62 0.11
63 0.12
64 0.12
65 0.11
66 0.1
67 0.09
68 0.08
69 0.06
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.1
80 0.16
81 0.17
82 0.19
83 0.21
84 0.25
85 0.33
86 0.33
87 0.33
88 0.3
89 0.31
90 0.3
91 0.3
92 0.27
93 0.21
94 0.26
95 0.32
96 0.34
97 0.38
98 0.43
99 0.48
100 0.57
101 0.65
102 0.69
103 0.72
104 0.76
105 0.81
106 0.86
107 0.88
108 0.88
109 0.87
110 0.86
111 0.8
112 0.71
113 0.62
114 0.54
115 0.46
116 0.37
117 0.28
118 0.21
119 0.21
120 0.21
121 0.19