Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094DRE8

Protein Details
Accession A0A094DRE8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-79NKASAPKKPIFRRTPRAPTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MGWLWSSAATPADAAAPTSQPTSTPAQQSPPPATPSQPLTPAQIAEQDLQAALAEFDAENKASAPKKPIFRRTPRAPTEDTPGSATPDSELNVEDSLYPTTMSCRDAFDSAFYCQSLGGQFNAVYRYGGMQSCSDHWKDFWFCMRSKSYAGQREDMIKEHYRKKALKYKVGPSSEDVWEGREKRMEWGEAFSQGVEELLPGESDEEWNVRERKRREGRNSGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.12
5 0.13
6 0.13
7 0.12
8 0.15
9 0.21
10 0.24
11 0.29
12 0.29
13 0.33
14 0.37
15 0.42
16 0.44
17 0.42
18 0.41
19 0.37
20 0.37
21 0.36
22 0.38
23 0.36
24 0.35
25 0.32
26 0.32
27 0.32
28 0.3
29 0.27
30 0.25
31 0.23
32 0.2
33 0.19
34 0.14
35 0.13
36 0.12
37 0.11
38 0.07
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.11
49 0.13
50 0.15
51 0.2
52 0.25
53 0.34
54 0.42
55 0.52
56 0.57
57 0.65
58 0.73
59 0.76
60 0.81
61 0.76
62 0.74
63 0.68
64 0.61
65 0.59
66 0.51
67 0.43
68 0.36
69 0.31
70 0.28
71 0.23
72 0.21
73 0.14
74 0.13
75 0.12
76 0.1
77 0.1
78 0.08
79 0.08
80 0.08
81 0.07
82 0.08
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.08
89 0.1
90 0.09
91 0.1
92 0.11
93 0.12
94 0.12
95 0.12
96 0.13
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.09
103 0.08
104 0.07
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.09
111 0.08
112 0.07
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.12
120 0.15
121 0.16
122 0.15
123 0.14
124 0.18
125 0.19
126 0.2
127 0.25
128 0.25
129 0.25
130 0.29
131 0.32
132 0.3
133 0.31
134 0.35
135 0.36
136 0.41
137 0.43
138 0.4
139 0.38
140 0.42
141 0.41
142 0.36
143 0.33
144 0.32
145 0.35
146 0.4
147 0.44
148 0.46
149 0.48
150 0.55
151 0.59
152 0.61
153 0.65
154 0.64
155 0.68
156 0.69
157 0.69
158 0.62
159 0.56
160 0.53
161 0.44
162 0.4
163 0.31
164 0.25
165 0.29
166 0.29
167 0.28
168 0.28
169 0.27
170 0.3
171 0.34
172 0.34
173 0.29
174 0.32
175 0.31
176 0.28
177 0.28
178 0.22
179 0.18
180 0.15
181 0.14
182 0.08
183 0.07
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.08
191 0.09
192 0.1
193 0.11
194 0.18
195 0.23
196 0.27
197 0.36
198 0.38
199 0.48
200 0.57
201 0.67
202 0.7
203 0.76