Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094E6B1

Protein Details
Accession A0A094E6B1   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-74LVDPKTMSRKRKRVRKFDKTPALVRHydrophilic
NLS Segment(s)
PositionSequence
57-74SRKRKRVRKFDKTPALVR
80-81AR
85-87GKG
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDPDPTSPEGPEPLKHRLGHYFKTTKKGRVIENWVLIKDSEGKITRKVDLVDPKTMSRKRKRVRKFDKTPALVRVASGGARIGDGKGKGKDEGDGVEEGAEGVAEDKVKKKKKCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.4
4 0.44
5 0.48
6 0.49
7 0.53
8 0.56
9 0.53
10 0.62
11 0.64
12 0.6
13 0.62
14 0.61
15 0.57
16 0.56
17 0.61
18 0.58
19 0.6
20 0.55
21 0.48
22 0.44
23 0.38
24 0.31
25 0.27
26 0.21
27 0.19
28 0.2
29 0.21
30 0.25
31 0.27
32 0.27
33 0.25
34 0.25
35 0.26
36 0.31
37 0.33
38 0.32
39 0.32
40 0.33
41 0.39
42 0.42
43 0.46
44 0.46
45 0.53
46 0.57
47 0.66
48 0.74
49 0.77
50 0.84
51 0.86
52 0.86
53 0.86
54 0.87
55 0.82
56 0.76
57 0.68
58 0.61
59 0.5
60 0.4
61 0.31
62 0.22
63 0.17
64 0.14
65 0.11
66 0.07
67 0.07
68 0.08
69 0.07
70 0.09
71 0.11
72 0.15
73 0.17
74 0.19
75 0.2
76 0.2
77 0.21
78 0.19
79 0.19
80 0.17
81 0.15
82 0.14
83 0.12
84 0.11
85 0.1
86 0.08
87 0.06
88 0.04
89 0.04
90 0.05
91 0.06
92 0.08
93 0.15
94 0.25
95 0.35
96 0.4
97 0.49