Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q753L8

Protein Details
Accession Q753L8   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
319-340SSVPTLIVRKKLKRARRRGIFDHydrophilic
NLS Segment(s)
PositionSequence
327-337RKKLKRARRRG
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, mito 8, nucl 7.5
Family & Domain DBs
Gene Ontology GO:0003713  F:transcription coactivator activity  
GO:0000429  P:carbon catabolite regulation of transcription from RNA polymerase II promoter  
KEGG ago:AGOS_AFR294W  -  
Amino Acid Sequences MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGVTIKIEEPPEQRGRTRNKQSGAAFSSSRSRTKSRSRSRVSVTDQEFLRWTILRADPSERLHLGAVEDEEDDDELSDEEQLSDVENDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDVLQDTCTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLCDAVDVESHLNRVAEQVAFLLDCSAAALDDLDVVVLALQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.19
5 0.17
6 0.15
7 0.14
8 0.15
9 0.12
10 0.11
11 0.1
12 0.08
13 0.07
14 0.07
15 0.08
16 0.07
17 0.06
18 0.05
19 0.06
20 0.08
21 0.1
22 0.16
23 0.19
24 0.21
25 0.23
26 0.28
27 0.29
28 0.29
29 0.29
30 0.28
31 0.29
32 0.28
33 0.27
34 0.25
35 0.25
36 0.26
37 0.26
38 0.25
39 0.23
40 0.29
41 0.35
42 0.35
43 0.37
44 0.44
45 0.52
46 0.58
47 0.66
48 0.66
49 0.63
50 0.68
51 0.66
52 0.66
53 0.61
54 0.54
55 0.44
56 0.38
57 0.43
58 0.38
59 0.39
60 0.35
61 0.35
62 0.39
63 0.49
64 0.58
65 0.61
66 0.68
67 0.72
68 0.76
69 0.78
70 0.79
71 0.75
72 0.73
73 0.66
74 0.61
75 0.53
76 0.47
77 0.41
78 0.33
79 0.28
80 0.2
81 0.17
82 0.16
83 0.19
84 0.2
85 0.2
86 0.24
87 0.26
88 0.28
89 0.32
90 0.27
91 0.25
92 0.23
93 0.21
94 0.18
95 0.14
96 0.12
97 0.09
98 0.09
99 0.07
100 0.07
101 0.07
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.05
108 0.04
109 0.04
110 0.05
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.05
119 0.06
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.07
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.11
152 0.12
153 0.11
154 0.15
155 0.18
156 0.23
157 0.24
158 0.23
159 0.2
160 0.23
161 0.25
162 0.21
163 0.17
164 0.12
165 0.11
166 0.11
167 0.1
168 0.07
169 0.06
170 0.07
171 0.08
172 0.09
173 0.1
174 0.11
175 0.11
176 0.17
177 0.2
178 0.26
179 0.28
180 0.3
181 0.31
182 0.31
183 0.33
184 0.29
185 0.26
186 0.21
187 0.19
188 0.18
189 0.16
190 0.17
191 0.15
192 0.13
193 0.12
194 0.11
195 0.11
196 0.09
197 0.09
198 0.09
199 0.09
200 0.08
201 0.08
202 0.07
203 0.06
204 0.06
205 0.06
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.07
215 0.07
216 0.06
217 0.06
218 0.06
219 0.07
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.08
226 0.1
227 0.08
228 0.06
229 0.05
230 0.06
231 0.05
232 0.06
233 0.06
234 0.05
235 0.04
236 0.05
237 0.07
238 0.07
239 0.08
240 0.09
241 0.09
242 0.08
243 0.1
244 0.11
245 0.09
246 0.09
247 0.08
248 0.08
249 0.08
250 0.08
251 0.07
252 0.05
253 0.05
254 0.05
255 0.05
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.04
270 0.06
271 0.07
272 0.09
273 0.11
274 0.12
275 0.14
276 0.14
277 0.16
278 0.16
279 0.25
280 0.27
281 0.28
282 0.28
283 0.27
284 0.26
285 0.25
286 0.24
287 0.14
288 0.12
289 0.1
290 0.1
291 0.1
292 0.12
293 0.12
294 0.11
295 0.11
296 0.11
297 0.11
298 0.12
299 0.11
300 0.09
301 0.09
302 0.09
303 0.1
304 0.11
305 0.12
306 0.11
307 0.1
308 0.1
309 0.13
310 0.19
311 0.22
312 0.29
313 0.36
314 0.44
315 0.55
316 0.64
317 0.72
318 0.77
319 0.84
320 0.86