Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GBA9

Protein Details
Accession C5GBA9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AKSKNSSQKTVNKKAHRNGIKKHydrophilic
NLS Segment(s)
PositionSequence
13-62NKKAHRNGIKKPKTHRYPSLRGTDPKFRRNHRHALHGTMKALKEMREGKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQKTVNKKAHRNGIKKPKTHRYPSLRGTDPKFRRNHRHALHGTMKALKEMREGKRESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.82
4 0.83
5 0.79
6 0.78
7 0.8
8 0.78
9 0.75
10 0.76
11 0.76
12 0.75
13 0.76
14 0.75
15 0.73
16 0.73
17 0.73
18 0.71
19 0.65
20 0.61
21 0.58
22 0.59
23 0.56
24 0.55
25 0.56
26 0.56
27 0.62
28 0.64
29 0.7
30 0.63
31 0.68
32 0.63
33 0.64
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.38
41 0.31
42 0.31
43 0.36
44 0.41
45 0.44