Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094E201

Protein Details
Accession A0A094E201   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
368-393RAALNGPSRKINKKRKDRRWAKCVVSHydrophilic
NLS Segment(s)
PositionSequence
374-387PSRKINKKRKDRRW
Subcellular Location(s) cyto 9.5, cyto_nucl 9, nucl 7.5, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019364  Mediatior_Med8_fun/met  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0016592  C:mediator complex  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF10232  Med8  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51420  RHO  
CDD cd00157  Rho  
Amino Acid Sequences MTSLNSDEMRAIDQTRTRLDQLTKSIGALKNDILRSPVMPPIDSIQVHSTILAQSLKNITDHLSKHSDLFSQTVVYPSTNFPGRTQEGLIGQLLRKKLEPSAESWVEEGRALGKPDSEGAGRDEDLDELWSFAKEYVLPQVAKAAQLSRSSLDDIYAESDEEDEEEEEEEEGEGEGGEKAHAGIHSENGINFNANRKLTIVGIWESGKTSLLQAALQGRYPPKEQPFDQCPGLYTCTVLNEAGEDSQVELVLWDSGGGYEQCRLEVLKYAYVDVVVIVFAIDLPDQLEVIEESWLPQVEYSAPGVPIVLVGLRKDLRDKPDIDGSKKATFISKKLGERLAHRIRAFAFVECSSFTGEGISEVFEAAARAALNGPSRKINKKRKDRRWAKCVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.35
4 0.35
5 0.39
6 0.42
7 0.43
8 0.46
9 0.48
10 0.43
11 0.4
12 0.46
13 0.43
14 0.41
15 0.37
16 0.34
17 0.34
18 0.35
19 0.34
20 0.29
21 0.26
22 0.25
23 0.25
24 0.26
25 0.21
26 0.2
27 0.21
28 0.22
29 0.27
30 0.25
31 0.26
32 0.24
33 0.24
34 0.23
35 0.22
36 0.2
37 0.14
38 0.17
39 0.17
40 0.14
41 0.16
42 0.19
43 0.2
44 0.19
45 0.19
46 0.19
47 0.23
48 0.24
49 0.27
50 0.29
51 0.29
52 0.3
53 0.31
54 0.3
55 0.25
56 0.26
57 0.21
58 0.17
59 0.17
60 0.17
61 0.17
62 0.15
63 0.15
64 0.15
65 0.19
66 0.21
67 0.21
68 0.21
69 0.27
70 0.29
71 0.29
72 0.29
73 0.27
74 0.24
75 0.25
76 0.24
77 0.19
78 0.18
79 0.19
80 0.2
81 0.18
82 0.18
83 0.18
84 0.2
85 0.24
86 0.24
87 0.25
88 0.32
89 0.33
90 0.32
91 0.31
92 0.29
93 0.23
94 0.21
95 0.17
96 0.11
97 0.12
98 0.13
99 0.12
100 0.12
101 0.12
102 0.13
103 0.15
104 0.13
105 0.11
106 0.12
107 0.13
108 0.13
109 0.13
110 0.13
111 0.11
112 0.11
113 0.11
114 0.09
115 0.08
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.06
122 0.07
123 0.12
124 0.15
125 0.15
126 0.15
127 0.18
128 0.18
129 0.19
130 0.18
131 0.16
132 0.15
133 0.16
134 0.17
135 0.15
136 0.15
137 0.16
138 0.15
139 0.14
140 0.11
141 0.1
142 0.11
143 0.1
144 0.09
145 0.07
146 0.07
147 0.07
148 0.06
149 0.07
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.09
173 0.09
174 0.09
175 0.1
176 0.1
177 0.09
178 0.09
179 0.12
180 0.15
181 0.15
182 0.15
183 0.14
184 0.15
185 0.14
186 0.15
187 0.13
188 0.1
189 0.11
190 0.11
191 0.11
192 0.1
193 0.1
194 0.1
195 0.08
196 0.07
197 0.07
198 0.07
199 0.07
200 0.08
201 0.12
202 0.12
203 0.12
204 0.14
205 0.14
206 0.16
207 0.17
208 0.21
209 0.22
210 0.26
211 0.27
212 0.32
213 0.36
214 0.37
215 0.37
216 0.32
217 0.29
218 0.27
219 0.27
220 0.2
221 0.16
222 0.12
223 0.12
224 0.12
225 0.11
226 0.09
227 0.07
228 0.08
229 0.07
230 0.07
231 0.06
232 0.05
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.03
241 0.03
242 0.03
243 0.05
244 0.05
245 0.05
246 0.08
247 0.08
248 0.08
249 0.09
250 0.09
251 0.09
252 0.15
253 0.17
254 0.17
255 0.18
256 0.18
257 0.18
258 0.17
259 0.16
260 0.1
261 0.08
262 0.04
263 0.04
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.04
273 0.04
274 0.05
275 0.05
276 0.05
277 0.06
278 0.05
279 0.07
280 0.08
281 0.09
282 0.08
283 0.08
284 0.08
285 0.08
286 0.1
287 0.11
288 0.11
289 0.11
290 0.11
291 0.11
292 0.1
293 0.09
294 0.08
295 0.07
296 0.06
297 0.07
298 0.12
299 0.13
300 0.14
301 0.19
302 0.24
303 0.28
304 0.33
305 0.35
306 0.35
307 0.44
308 0.49
309 0.48
310 0.49
311 0.49
312 0.46
313 0.45
314 0.42
315 0.39
316 0.37
317 0.37
318 0.4
319 0.42
320 0.44
321 0.48
322 0.54
323 0.49
324 0.51
325 0.58
326 0.57
327 0.57
328 0.53
329 0.51
330 0.46
331 0.48
332 0.45
333 0.36
334 0.31
335 0.24
336 0.25
337 0.23
338 0.22
339 0.19
340 0.17
341 0.15
342 0.12
343 0.11
344 0.1
345 0.1
346 0.1
347 0.08
348 0.08
349 0.08
350 0.07
351 0.07
352 0.07
353 0.08
354 0.07
355 0.07
356 0.09
357 0.12
358 0.19
359 0.22
360 0.24
361 0.31
362 0.38
363 0.48
364 0.57
365 0.65
366 0.69
367 0.78
368 0.86
369 0.89
370 0.94
371 0.95
372 0.95
373 0.93