Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094ARW0

Protein Details
Accession A0A094ARW0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
61-86QEKIGRNGKKKRLRLHHEFRKQKKAEBasic
NLS Segment(s)
PositionSequence
64-91IGRNGKKKRLRLHHEFRKQKKAEAKLRG
Subcellular Location(s) nucl 13, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033871  LSm5  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01732  LSm5  
Amino Acid Sequences MSYKELNETPARPPTPPYVPPVTIKERIKAQFISWGHDIDAHLRDLFRVSGGPYYYQVVAQEKIGRNGKKKRLRLHHEFRKQKKAEAKLRGERYIQPKDPYRTYGTVKLNPVLHDKDKEAAVLQPYVSHNDNDTITPACKIWVVMKTDKEFTGTLTGFDDYVNMVLEDVTEFDYTGATTKMEKILLNGNNICMLIPGGEGPLASAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.44
4 0.44
5 0.42
6 0.43
7 0.47
8 0.5
9 0.5
10 0.51
11 0.5
12 0.49
13 0.5
14 0.5
15 0.5
16 0.45
17 0.39
18 0.39
19 0.38
20 0.39
21 0.32
22 0.3
23 0.25
24 0.26
25 0.26
26 0.21
27 0.22
28 0.17
29 0.17
30 0.16
31 0.16
32 0.15
33 0.14
34 0.11
35 0.1
36 0.09
37 0.12
38 0.13
39 0.14
40 0.14
41 0.16
42 0.15
43 0.15
44 0.16
45 0.15
46 0.15
47 0.15
48 0.21
49 0.21
50 0.27
51 0.34
52 0.36
53 0.41
54 0.5
55 0.59
56 0.61
57 0.67
58 0.7
59 0.74
60 0.78
61 0.8
62 0.82
63 0.82
64 0.84
65 0.86
66 0.84
67 0.84
68 0.77
69 0.72
70 0.69
71 0.68
72 0.67
73 0.66
74 0.67
75 0.65
76 0.68
77 0.65
78 0.59
79 0.55
80 0.54
81 0.52
82 0.46
83 0.42
84 0.44
85 0.45
86 0.44
87 0.42
88 0.39
89 0.35
90 0.34
91 0.38
92 0.36
93 0.36
94 0.36
95 0.36
96 0.33
97 0.31
98 0.32
99 0.28
100 0.26
101 0.23
102 0.23
103 0.22
104 0.2
105 0.19
106 0.16
107 0.14
108 0.13
109 0.12
110 0.11
111 0.12
112 0.12
113 0.15
114 0.16
115 0.14
116 0.14
117 0.15
118 0.16
119 0.13
120 0.14
121 0.12
122 0.12
123 0.12
124 0.11
125 0.1
126 0.1
127 0.1
128 0.12
129 0.15
130 0.2
131 0.24
132 0.29
133 0.31
134 0.33
135 0.32
136 0.31
137 0.26
138 0.23
139 0.25
140 0.2
141 0.18
142 0.18
143 0.18
144 0.15
145 0.15
146 0.14
147 0.07
148 0.08
149 0.08
150 0.06
151 0.06
152 0.05
153 0.06
154 0.05
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.09
163 0.08
164 0.07
165 0.09
166 0.11
167 0.13
168 0.15
169 0.15
170 0.16
171 0.24
172 0.27
173 0.32
174 0.31
175 0.3
176 0.29
177 0.29
178 0.27
179 0.18
180 0.15
181 0.09
182 0.08
183 0.08
184 0.07
185 0.07
186 0.07