Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B383

Protein Details
Accession A0A094B383    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
115-137TSSANWGKKARKRQRAMIKRIIEHydrophilic
NLS Segment(s)
PositionSequence
122-132KKARKRQRAMI
Subcellular Location(s) cyto 12.5, cyto_nucl 11, nucl 6.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAEFNDLIGTVTGYLQQGFDNLKHNAEHYASMSLKEWVRIITIVGAYLLLRPYLSLWAAKLQSAQHDKEIDADEMATPATGAKAAISANSLRGQVKVPEDSESDEDTGEAETAETSSANWGKKARKRQRAMIKRIIEADEKLRAETEAYDDEEDKDIEQYLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.11
5 0.12
6 0.14
7 0.18
8 0.19
9 0.2
10 0.2
11 0.21
12 0.23
13 0.22
14 0.21
15 0.18
16 0.22
17 0.2
18 0.21
19 0.21
20 0.21
21 0.21
22 0.2
23 0.19
24 0.14
25 0.15
26 0.14
27 0.13
28 0.11
29 0.11
30 0.09
31 0.09
32 0.08
33 0.07
34 0.08
35 0.07
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.07
43 0.08
44 0.12
45 0.13
46 0.13
47 0.14
48 0.13
49 0.19
50 0.23
51 0.23
52 0.22
53 0.23
54 0.23
55 0.24
56 0.25
57 0.18
58 0.14
59 0.13
60 0.1
61 0.09
62 0.09
63 0.06
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.07
76 0.09
77 0.1
78 0.09
79 0.1
80 0.12
81 0.13
82 0.15
83 0.16
84 0.15
85 0.16
86 0.16
87 0.18
88 0.19
89 0.18
90 0.16
91 0.14
92 0.13
93 0.11
94 0.1
95 0.08
96 0.06
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.08
104 0.12
105 0.13
106 0.15
107 0.2
108 0.29
109 0.36
110 0.48
111 0.54
112 0.61
113 0.67
114 0.75
115 0.81
116 0.83
117 0.85
118 0.84
119 0.78
120 0.71
121 0.68
122 0.61
123 0.52
124 0.44
125 0.39
126 0.36
127 0.32
128 0.29
129 0.26
130 0.23
131 0.22
132 0.2
133 0.2
134 0.16
135 0.18
136 0.19
137 0.2
138 0.21
139 0.22
140 0.22
141 0.18
142 0.16