Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BL77

Protein Details
Accession A0A094BL77   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MFKRSHRSRDRVEKVSRLKKNLKDAAKBasic
NLS Segment(s)
PositionSequence
11-11R
13-21EKVSRLKKN
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MFKRSHRSRDRVEKVSRLKKNLKDAAKSSKLQRSFEEDNPLLGAPLISPVITLMVGKEGRLFAAHEDVLCLSPFFAAVCRGKFLDAQSKRIELPDEEPEIFSCILEYLYKGDYYPRALQNKRRSTWELEDAVGSPNPENGGGRGNTEATTYVSSVGEYLLRDTVIYCLADKYGLEELKRLALRKQGLQSGIEVGTILRSARYAYDNTPDTDSRLRAHYLALIIRCRKTFKRSGTMQTEMESGGKLFFDLFVALCNHVDDIVDIGNSRSPKTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.82
4 0.8
5 0.8
6 0.78
7 0.81
8 0.8
9 0.77
10 0.75
11 0.73
12 0.74
13 0.72
14 0.69
15 0.67
16 0.66
17 0.64
18 0.59
19 0.56
20 0.54
21 0.53
22 0.53
23 0.54
24 0.46
25 0.41
26 0.4
27 0.36
28 0.28
29 0.21
30 0.17
31 0.07
32 0.08
33 0.08
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.1
42 0.1
43 0.1
44 0.12
45 0.11
46 0.12
47 0.12
48 0.13
49 0.09
50 0.13
51 0.14
52 0.12
53 0.13
54 0.13
55 0.13
56 0.13
57 0.11
58 0.07
59 0.06
60 0.07
61 0.06
62 0.06
63 0.1
64 0.13
65 0.14
66 0.15
67 0.16
68 0.17
69 0.18
70 0.21
71 0.26
72 0.26
73 0.3
74 0.31
75 0.32
76 0.31
77 0.31
78 0.29
79 0.2
80 0.22
81 0.22
82 0.23
83 0.22
84 0.22
85 0.21
86 0.21
87 0.19
88 0.15
89 0.1
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.09
99 0.1
100 0.14
101 0.19
102 0.23
103 0.3
104 0.34
105 0.43
106 0.52
107 0.59
108 0.56
109 0.57
110 0.54
111 0.52
112 0.53
113 0.5
114 0.41
115 0.33
116 0.31
117 0.27
118 0.24
119 0.19
120 0.15
121 0.09
122 0.07
123 0.07
124 0.07
125 0.06
126 0.06
127 0.08
128 0.08
129 0.09
130 0.09
131 0.1
132 0.09
133 0.1
134 0.1
135 0.08
136 0.09
137 0.08
138 0.08
139 0.08
140 0.07
141 0.07
142 0.07
143 0.07
144 0.06
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.09
159 0.12
160 0.13
161 0.13
162 0.14
163 0.15
164 0.2
165 0.22
166 0.2
167 0.18
168 0.22
169 0.25
170 0.29
171 0.32
172 0.31
173 0.31
174 0.3
175 0.29
176 0.25
177 0.23
178 0.17
179 0.14
180 0.09
181 0.08
182 0.08
183 0.07
184 0.05
185 0.05
186 0.05
187 0.07
188 0.1
189 0.12
190 0.13
191 0.2
192 0.22
193 0.24
194 0.27
195 0.26
196 0.27
197 0.29
198 0.29
199 0.24
200 0.25
201 0.25
202 0.22
203 0.22
204 0.21
205 0.19
206 0.22
207 0.23
208 0.27
209 0.3
210 0.33
211 0.34
212 0.38
213 0.4
214 0.44
215 0.49
216 0.51
217 0.56
218 0.6
219 0.67
220 0.68
221 0.69
222 0.62
223 0.55
224 0.48
225 0.39
226 0.32
227 0.23
228 0.16
229 0.12
230 0.1
231 0.09
232 0.08
233 0.07
234 0.07
235 0.07
236 0.07
237 0.09
238 0.11
239 0.12
240 0.12
241 0.13
242 0.12
243 0.12
244 0.12
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.1
251 0.14
252 0.15