Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094EDS7

Protein Details
Accession A0A094EDS7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
161-189DSASNISSSRHRRPKRRNERRTPALVEEEHydrophilic
NLS Segment(s)
PositionSequence
170-181RHRRPKRRNERR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences PTPAGRYPFSPPPLRNAFDTSPPPSRNPTPAAFPPPSIPGTPFQGGRHPVSSDEDAEIAVLAEIERDIYAGMEALEDAFEGLHRKAEVVRQALRQRGAGLAMAAQSRRGGNIGVGVRAATPGGESVGGWGGGGGMNGGGYNLGEESESGSEWAEEEIAPDDSASNISSSRHRRPKRRNERRTPALVEEEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.49
4 0.45
5 0.44
6 0.48
7 0.45
8 0.47
9 0.47
10 0.47
11 0.46
12 0.48
13 0.46
14 0.46
15 0.42
16 0.41
17 0.44
18 0.49
19 0.44
20 0.41
21 0.38
22 0.36
23 0.36
24 0.3
25 0.26
26 0.21
27 0.25
28 0.26
29 0.26
30 0.24
31 0.28
32 0.31
33 0.32
34 0.31
35 0.27
36 0.26
37 0.28
38 0.29
39 0.24
40 0.21
41 0.18
42 0.15
43 0.14
44 0.12
45 0.08
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.02
66 0.03
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.08
73 0.11
74 0.16
75 0.18
76 0.2
77 0.25
78 0.29
79 0.32
80 0.32
81 0.29
82 0.25
83 0.21
84 0.19
85 0.13
86 0.1
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.11
99 0.11
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.09
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.02
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.05
142 0.06
143 0.08
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.09
150 0.09
151 0.08
152 0.07
153 0.1
154 0.18
155 0.25
156 0.36
157 0.45
158 0.55
159 0.65
160 0.75
161 0.85
162 0.89
163 0.93
164 0.94
165 0.94
166 0.96
167 0.94
168 0.91
169 0.86
170 0.81
171 0.76
172 0.66