Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GEQ5

Protein Details
Accession C5GEQ5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
116-145SLYANWKKLSPKKRLKRRKILQKKGLPIPNHydrophilic
NLS Segment(s)
PositionSequence
122-141KKLSPKKRLKRRKILQKKGL
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 11.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSPAEEHVTEAYPVKDTAAEVYLIEECAIEEPSTEAYPVEEPAEEEPAPEEPLFEDCPVEDPLAEDPPQEEPLTEAYPIEEPLVEECPIGEPPAETYATDQHPAEEPPLEEHPDVSLYANWKKLSPKKRLKRRKILQKKGLPIPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.13
5 0.12
6 0.12
7 0.1
8 0.12
9 0.12
10 0.11
11 0.11
12 0.08
13 0.07
14 0.08
15 0.09
16 0.07
17 0.07
18 0.07
19 0.09
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.1
26 0.1
27 0.08
28 0.09
29 0.1
30 0.13
31 0.12
32 0.11
33 0.11
34 0.12
35 0.13
36 0.12
37 0.11
38 0.08
39 0.1
40 0.12
41 0.11
42 0.1
43 0.08
44 0.11
45 0.12
46 0.11
47 0.09
48 0.08
49 0.1
50 0.11
51 0.11
52 0.09
53 0.08
54 0.1
55 0.12
56 0.11
57 0.09
58 0.08
59 0.1
60 0.11
61 0.1
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.06
68 0.05
69 0.06
70 0.09
71 0.08
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.07
78 0.06
79 0.07
80 0.09
81 0.1
82 0.08
83 0.1
84 0.14
85 0.15
86 0.17
87 0.16
88 0.15
89 0.16
90 0.17
91 0.17
92 0.14
93 0.13
94 0.15
95 0.18
96 0.19
97 0.18
98 0.17
99 0.17
100 0.16
101 0.16
102 0.14
103 0.13
104 0.15
105 0.19
106 0.23
107 0.23
108 0.25
109 0.33
110 0.41
111 0.48
112 0.54
113 0.62
114 0.68
115 0.79
116 0.88
117 0.9
118 0.92
119 0.94
120 0.95
121 0.95
122 0.96
123 0.95
124 0.94
125 0.92