Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AVV6

Protein Details
Accession A0A094AVV6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-74QLHQHKSDKMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
48-74DKMRAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MMSFTDIMTSARPIACQFGASETLNYQPSLLTTTSSLLHHQLHQHKSDKMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.14
6 0.17
7 0.17
8 0.17
9 0.14
10 0.16
11 0.17
12 0.16
13 0.14
14 0.1
15 0.1
16 0.12
17 0.11
18 0.09
19 0.08
20 0.09
21 0.11
22 0.11
23 0.12
24 0.12
25 0.12
26 0.13
27 0.19
28 0.25
29 0.27
30 0.32
31 0.35
32 0.36
33 0.4
34 0.47
35 0.5
36 0.49
37 0.57
38 0.63
39 0.7
40 0.77
41 0.84
42 0.87
43 0.88
44 0.93
45 0.94
46 0.95
47 0.95
48 0.96
49 0.96
50 0.97
51 0.97
52 0.98
53 0.97
54 0.97