Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BDV6

Protein Details
Accession A0A094BDV6   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
146-171GEGVASQGRRRRRRRRYARGFWPLEAHydrophilic
NLS Segment(s)
PositionSequence
153-164GRRRRRRRRYAR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MSSEPHATALGRTQGLSLRPLQQETITMSDDETNKALGRSVADGFSMHEIQHQMERTTRRNQTLMEIAAARASNKIIEIDEGYEDRSGGAQMNAPSCDGNLIIEIGAVHEAGTGEVPLGMAAGATNETVVGRDNRGETGEVQIRVGEGVASQGRRRRRRRRYARGFWPLEAEPRTPRMPLSNWEDYDLLRESFFNGNHGRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.23
5 0.26
6 0.28
7 0.29
8 0.29
9 0.26
10 0.27
11 0.28
12 0.28
13 0.22
14 0.19
15 0.19
16 0.21
17 0.22
18 0.21
19 0.18
20 0.16
21 0.15
22 0.15
23 0.15
24 0.12
25 0.12
26 0.13
27 0.14
28 0.13
29 0.13
30 0.13
31 0.13
32 0.16
33 0.15
34 0.12
35 0.13
36 0.13
37 0.14
38 0.18
39 0.19
40 0.16
41 0.21
42 0.26
43 0.29
44 0.37
45 0.41
46 0.41
47 0.41
48 0.4
49 0.4
50 0.39
51 0.35
52 0.28
53 0.23
54 0.19
55 0.18
56 0.18
57 0.14
58 0.09
59 0.09
60 0.07
61 0.07
62 0.08
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.07
86 0.06
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.05
117 0.06
118 0.07
119 0.08
120 0.09
121 0.1
122 0.11
123 0.12
124 0.11
125 0.16
126 0.2
127 0.19
128 0.18
129 0.18
130 0.17
131 0.16
132 0.15
133 0.09
134 0.04
135 0.07
136 0.09
137 0.11
138 0.14
139 0.2
140 0.29
141 0.4
142 0.51
143 0.59
144 0.68
145 0.77
146 0.86
147 0.92
148 0.94
149 0.94
150 0.94
151 0.94
152 0.87
153 0.76
154 0.7
155 0.6
156 0.56
157 0.48
158 0.4
159 0.33
160 0.34
161 0.34
162 0.29
163 0.29
164 0.28
165 0.29
166 0.33
167 0.38
168 0.41
169 0.41
170 0.43
171 0.42
172 0.37
173 0.37
174 0.33
175 0.26
176 0.18
177 0.17
178 0.17
179 0.21
180 0.22
181 0.23