Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GGM4

Protein Details
Accession C5GGM4   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
3-23EFPGAKRVRREDLRSRRSSRSBasic
239-308LNPLTTKAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATLRDGRGEQBasic
NLS Segment(s)
PositionSequence
245-301KAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATL
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFEFPGAKRVRREDLRSRRSSRSPSPPDSTAATYAANALRNIFSSVETYTPPTPKATHPEPDLEHIQDEEEEQEFEFRLFHVPPARAGKCVSEPTRGVKSRDESEGDHNNGPQQIDVKDAGIQKFRIKLRSPTPTANDGVGGFVVPFRGWEYYFSDPEWAKRKMAGDRIEARTVDLDTRQKQIFVDAAVSGETILEGAKKCAWPGCHLPWRVIHLQTTPSKTKSKVPSDSSQTKGVTLLNPLTTKAPKSRKKPGKKRRIVLRRRLAATRTAEAAEREKRMRRNREKKIKKRLKEKEKKATLRDGRGEQEGSAGREMMNNDRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.81
4 0.81
5 0.8
6 0.8
7 0.8
8 0.78
9 0.78
10 0.77
11 0.75
12 0.75
13 0.69
14 0.63
15 0.59
16 0.53
17 0.44
18 0.36
19 0.29
20 0.22
21 0.23
22 0.23
23 0.21
24 0.18
25 0.18
26 0.17
27 0.17
28 0.19
29 0.16
30 0.14
31 0.14
32 0.15
33 0.15
34 0.15
35 0.18
36 0.21
37 0.22
38 0.23
39 0.24
40 0.25
41 0.28
42 0.35
43 0.37
44 0.39
45 0.39
46 0.44
47 0.43
48 0.46
49 0.45
50 0.38
51 0.34
52 0.27
53 0.25
54 0.19
55 0.17
56 0.14
57 0.11
58 0.1
59 0.09
60 0.1
61 0.09
62 0.09
63 0.08
64 0.07
65 0.1
66 0.1
67 0.13
68 0.18
69 0.19
70 0.24
71 0.32
72 0.32
73 0.31
74 0.31
75 0.31
76 0.3
77 0.36
78 0.34
79 0.3
80 0.31
81 0.35
82 0.43
83 0.44
84 0.42
85 0.4
86 0.42
87 0.4
88 0.42
89 0.39
90 0.33
91 0.36
92 0.4
93 0.39
94 0.35
95 0.32
96 0.31
97 0.29
98 0.27
99 0.21
100 0.16
101 0.13
102 0.14
103 0.14
104 0.12
105 0.15
106 0.17
107 0.19
108 0.19
109 0.2
110 0.2
111 0.26
112 0.28
113 0.3
114 0.3
115 0.35
116 0.39
117 0.46
118 0.48
119 0.47
120 0.48
121 0.46
122 0.44
123 0.38
124 0.31
125 0.22
126 0.18
127 0.13
128 0.09
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.05
135 0.06
136 0.06
137 0.08
138 0.12
139 0.15
140 0.16
141 0.16
142 0.19
143 0.18
144 0.22
145 0.26
146 0.24
147 0.21
148 0.22
149 0.25
150 0.26
151 0.32
152 0.32
153 0.32
154 0.37
155 0.4
156 0.4
157 0.36
158 0.33
159 0.26
160 0.23
161 0.18
162 0.15
163 0.17
164 0.17
165 0.21
166 0.21
167 0.2
168 0.2
169 0.2
170 0.18
171 0.13
172 0.12
173 0.08
174 0.08
175 0.08
176 0.08
177 0.06
178 0.05
179 0.04
180 0.03
181 0.03
182 0.04
183 0.05
184 0.06
185 0.08
186 0.08
187 0.09
188 0.12
189 0.13
190 0.16
191 0.22
192 0.3
193 0.36
194 0.37
195 0.38
196 0.38
197 0.42
198 0.41
199 0.36
200 0.3
201 0.24
202 0.29
203 0.32
204 0.35
205 0.34
206 0.34
207 0.36
208 0.37
209 0.43
210 0.46
211 0.5
212 0.52
213 0.54
214 0.58
215 0.62
216 0.68
217 0.63
218 0.59
219 0.51
220 0.43
221 0.39
222 0.33
223 0.26
224 0.21
225 0.2
226 0.18
227 0.18
228 0.19
229 0.21
230 0.21
231 0.23
232 0.29
233 0.38
234 0.43
235 0.5
236 0.61
237 0.68
238 0.77
239 0.85
240 0.88
241 0.89
242 0.91
243 0.92
244 0.92
245 0.93
246 0.92
247 0.91
248 0.91
249 0.88
250 0.82
251 0.78
252 0.69
253 0.66
254 0.6
255 0.52
256 0.43
257 0.36
258 0.33
259 0.3
260 0.35
261 0.32
262 0.33
263 0.36
264 0.41
265 0.49
266 0.58
267 0.67
268 0.71
269 0.77
270 0.83
271 0.88
272 0.93
273 0.94
274 0.96
275 0.95
276 0.94
277 0.94
278 0.94
279 0.94
280 0.94
281 0.94
282 0.93
283 0.94
284 0.93
285 0.88
286 0.88
287 0.86
288 0.84
289 0.8
290 0.75
291 0.68
292 0.63
293 0.58
294 0.46
295 0.44
296 0.38
297 0.33
298 0.29
299 0.25
300 0.2
301 0.22
302 0.25
303 0.26