Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B170

Protein Details
Accession A0A094B170   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
252-272EEEGRLKRRKIEEEQKKKDDEAcidic
NLS Segment(s)
PositionSequence
259-260RR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR004579  ERCC1/RAD10/SWI10  
IPR011335  Restrct_endonuc-II-like  
IPR010994  RuvA_2-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Amino Acid Sequences LRLPPTKGKSHALAPARPAVGMARHARGLRARPDDMRALPEPEVPPPAPGESVKELSKTGLVNNVTVVLCWSAAEGARYLELYKSFEHASAAGIMGLQAKGYAEQFVEFVTVPRGVNRTDAVGIVGAFGSVRAAVNARPEEVAVLSGWGEKKVKRWTEVVREPFRVAKAAKRGLGEGVEAIDEGRTEAVPLRDMDQYTRPKSPGMSRESETAQSKGKEGASESQPQPTKPFQLLELDSDSGGEEAMIAAEMEEEGRLKRRKIEEEQKKKDDELSGGIAAALAKLRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.45
4 0.4
5 0.36
6 0.3
7 0.26
8 0.28
9 0.29
10 0.25
11 0.29
12 0.29
13 0.33
14 0.36
15 0.4
16 0.42
17 0.45
18 0.46
19 0.45
20 0.49
21 0.51
22 0.47
23 0.46
24 0.39
25 0.36
26 0.33
27 0.35
28 0.32
29 0.28
30 0.32
31 0.26
32 0.24
33 0.23
34 0.23
35 0.2
36 0.19
37 0.22
38 0.21
39 0.25
40 0.25
41 0.24
42 0.23
43 0.22
44 0.24
45 0.2
46 0.16
47 0.2
48 0.19
49 0.18
50 0.18
51 0.2
52 0.17
53 0.17
54 0.16
55 0.1
56 0.09
57 0.08
58 0.08
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.1
69 0.11
70 0.11
71 0.13
72 0.13
73 0.14
74 0.14
75 0.12
76 0.12
77 0.1
78 0.1
79 0.07
80 0.06
81 0.06
82 0.07
83 0.06
84 0.05
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.07
95 0.06
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.11
102 0.11
103 0.12
104 0.12
105 0.12
106 0.11
107 0.11
108 0.1
109 0.09
110 0.08
111 0.07
112 0.06
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.09
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.09
130 0.05
131 0.05
132 0.04
133 0.06
134 0.06
135 0.07
136 0.09
137 0.09
138 0.15
139 0.23
140 0.25
141 0.26
142 0.31
143 0.36
144 0.44
145 0.52
146 0.54
147 0.51
148 0.51
149 0.5
150 0.46
151 0.41
152 0.35
153 0.28
154 0.24
155 0.27
156 0.29
157 0.3
158 0.29
159 0.29
160 0.26
161 0.26
162 0.21
163 0.13
164 0.1
165 0.07
166 0.06
167 0.06
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.07
175 0.07
176 0.09
177 0.1
178 0.12
179 0.14
180 0.14
181 0.17
182 0.22
183 0.29
184 0.31
185 0.34
186 0.32
187 0.31
188 0.34
189 0.38
190 0.39
191 0.38
192 0.38
193 0.37
194 0.39
195 0.41
196 0.43
197 0.38
198 0.33
199 0.32
200 0.28
201 0.27
202 0.27
203 0.25
204 0.22
205 0.21
206 0.26
207 0.25
208 0.32
209 0.32
210 0.36
211 0.37
212 0.37
213 0.39
214 0.36
215 0.37
216 0.32
217 0.32
218 0.26
219 0.31
220 0.31
221 0.3
222 0.3
223 0.26
224 0.23
225 0.22
226 0.2
227 0.14
228 0.12
229 0.08
230 0.04
231 0.04
232 0.04
233 0.04
234 0.03
235 0.03
236 0.03
237 0.04
238 0.04
239 0.04
240 0.05
241 0.07
242 0.15
243 0.2
244 0.22
245 0.3
246 0.37
247 0.46
248 0.55
249 0.65
250 0.68
251 0.75
252 0.84
253 0.83
254 0.79
255 0.72
256 0.67
257 0.6
258 0.51
259 0.44
260 0.38
261 0.31
262 0.28
263 0.26
264 0.21
265 0.17
266 0.15
267 0.13