Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BH56

Protein Details
Accession A0A094BH56   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-54STVKNDVQRQPKARKSNKRKASAITHydrophilic
117-138PSANASSKKRAKSRKQGGLQALHydrophilic
NLS Segment(s)
PositionSequence
41-49KARKSNKRK
124-131KKRAKSRK
Subcellular Location(s) nucl 22, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MFSNDIDQPDTRRGHVCGGCGNILTPGWTSTVKNDVQRQPKARKSNKRKASAITEAAERYTVYTCDRCNRETRHVITTAALPRVNPRRAEQPRLASGEGPERLSSTPQPQAGTPTMPSANASSKKRAKSRKQGGLQALLAKNKEASQSSSGGFGLDLMDLMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.35
4 0.32
5 0.33
6 0.32
7 0.28
8 0.27
9 0.2
10 0.17
11 0.16
12 0.12
13 0.1
14 0.11
15 0.12
16 0.13
17 0.14
18 0.2
19 0.22
20 0.27
21 0.35
22 0.4
23 0.48
24 0.55
25 0.61
26 0.65
27 0.7
28 0.75
29 0.77
30 0.81
31 0.83
32 0.85
33 0.86
34 0.85
35 0.8
36 0.75
37 0.73
38 0.68
39 0.62
40 0.52
41 0.45
42 0.37
43 0.33
44 0.28
45 0.2
46 0.15
47 0.11
48 0.1
49 0.1
50 0.12
51 0.14
52 0.21
53 0.24
54 0.24
55 0.3
56 0.34
57 0.39
58 0.44
59 0.45
60 0.42
61 0.4
62 0.39
63 0.33
64 0.32
65 0.27
66 0.22
67 0.19
68 0.15
69 0.2
70 0.27
71 0.29
72 0.27
73 0.26
74 0.35
75 0.39
76 0.45
77 0.44
78 0.42
79 0.43
80 0.45
81 0.43
82 0.33
83 0.3
84 0.29
85 0.26
86 0.22
87 0.18
88 0.16
89 0.16
90 0.17
91 0.18
92 0.17
93 0.2
94 0.21
95 0.22
96 0.21
97 0.25
98 0.24
99 0.24
100 0.2
101 0.19
102 0.17
103 0.17
104 0.18
105 0.16
106 0.21
107 0.26
108 0.29
109 0.35
110 0.41
111 0.48
112 0.56
113 0.64
114 0.68
115 0.72
116 0.8
117 0.81
118 0.82
119 0.83
120 0.8
121 0.75
122 0.67
123 0.64
124 0.57
125 0.5
126 0.43
127 0.35
128 0.31
129 0.26
130 0.28
131 0.23
132 0.23
133 0.23
134 0.25
135 0.25
136 0.26
137 0.24
138 0.2
139 0.18
140 0.13
141 0.11
142 0.08