Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094BSL2

Protein Details
Accession A0A094BSL2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85NSRILKGKCHRKDGKLTCVPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
Amino Acid Sequences MQFTAPLISAFALLAATQVLGAAVELPRDVAGILVATDPYYACNCPNNCSYKEGSGCRFYSGPSDNSRILKGKCHRKDGKLTCVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.03
19 0.03
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.07
30 0.13
31 0.13
32 0.16
33 0.2
34 0.24
35 0.24
36 0.27
37 0.28
38 0.27
39 0.31
40 0.32
41 0.32
42 0.33
43 0.32
44 0.31
45 0.3
46 0.25
47 0.27
48 0.27
49 0.27
50 0.26
51 0.3
52 0.31
53 0.32
54 0.35
55 0.36
56 0.33
57 0.39
58 0.44
59 0.51
60 0.55
61 0.64
62 0.68
63 0.7
64 0.8
65 0.79