Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094CAE8

Protein Details
Accession A0A094CAE8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSNKGSRKKSPTRKGSSRSPAPKVHydrophilic
NLS Segment(s)
PositionSequence
6-21GSRKKSPTRKGSSRSP
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043130  CDP-OH_PTrfase_TM_dom  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSNKGSRKKSPTRKGSSRSPAPKVSAEQPLLNGNRAAAASKEEHPYENIFLFWPNIIGYLRIVLALGSLYYMPLHPRTCTILYSVSCLLDALDGYAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.86
4 0.85
5 0.84
6 0.82
7 0.77
8 0.72
9 0.66
10 0.63
11 0.56
12 0.51
13 0.47
14 0.41
15 0.35
16 0.32
17 0.34
18 0.32
19 0.29
20 0.24
21 0.17
22 0.16
23 0.15
24 0.14
25 0.08
26 0.09
27 0.1
28 0.13
29 0.15
30 0.15
31 0.15
32 0.16
33 0.17
34 0.16
35 0.14
36 0.12
37 0.1
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.06
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.07
61 0.12
62 0.13
63 0.14
64 0.16
65 0.21
66 0.22
67 0.23
68 0.23
69 0.25
70 0.24
71 0.28
72 0.27
73 0.22
74 0.21
75 0.2
76 0.17
77 0.12
78 0.11