Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B2W9

Protein Details
Accession A0A094B2W9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-70QSCKSSLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKBasic
NLS Segment(s)
PositionSequence
36-62LRGGAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MLATHRADITNFLSPTHLRPLRKTIRLSRQSCKSSLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDNENKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.34
4 0.36
5 0.31
6 0.35
7 0.45
8 0.51
9 0.57
10 0.61
11 0.6
12 0.66
13 0.73
14 0.75
15 0.73
16 0.73
17 0.7
18 0.66
19 0.61
20 0.54
21 0.48
22 0.51
23 0.52
24 0.5
25 0.56
26 0.63
27 0.68
28 0.75
29 0.78
30 0.81
31 0.77
32 0.78
33 0.8
34 0.8
35 0.82
36 0.83
37 0.85
38 0.84
39 0.9
40 0.91
41 0.91
42 0.91
43 0.91
44 0.91
45 0.92
46 0.93
47 0.91
48 0.92
49 0.89
50 0.86
51 0.85
52 0.79
53 0.73
54 0.63
55 0.55
56 0.45
57 0.37
58 0.31
59 0.22
60 0.22
61 0.2
62 0.22
63 0.25
64 0.29
65 0.29
66 0.31
67 0.34
68 0.32
69 0.36
70 0.38
71 0.37
72 0.39
73 0.4
74 0.38
75 0.35
76 0.31
77 0.26
78 0.2
79 0.16
80 0.1
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.09
88 0.13
89 0.16
90 0.17
91 0.23
92 0.29
93 0.27
94 0.31
95 0.34
96 0.36
97 0.37
98 0.41
99 0.43