Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U4J2

Protein Details
Accession A0A179U4J2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKREREKKSITKLTEKKRIEBasic
86-105DFEMIITSDKKKKKKKKNEKBasic
NLS Segment(s)
PositionSequence
95-105KKKKKKKKNEK
Subcellular Location(s) nucl 12, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MKREREKKSITKLTEKKRIEVLFRSQMHFMIQNIKKTALLSEHINLLTAGMEPEAADQKMQDFEMQVDLAEEKQQESFSEKAAERDFEMIITSDKKKKKKKKNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.68
4 0.67
5 0.64
6 0.58
7 0.55
8 0.53
9 0.52
10 0.52
11 0.51
12 0.43
13 0.4
14 0.36
15 0.32
16 0.25
17 0.26
18 0.27
19 0.29
20 0.3
21 0.3
22 0.28
23 0.27
24 0.27
25 0.19
26 0.18
27 0.15
28 0.15
29 0.16
30 0.15
31 0.15
32 0.14
33 0.11
34 0.09
35 0.07
36 0.06
37 0.04
38 0.04
39 0.03
40 0.04
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.07
60 0.08
61 0.09
62 0.09
63 0.13
64 0.13
65 0.13
66 0.19
67 0.19
68 0.22
69 0.24
70 0.24
71 0.22
72 0.23
73 0.21
74 0.16
75 0.16
76 0.13
77 0.14
78 0.17
79 0.21
80 0.27
81 0.35
82 0.45
83 0.55
84 0.65
85 0.74