Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094B9K1

Protein Details
Accession A0A094B9K1    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
196-236TLSKPFKCAARRAKKLCRKIKKAKKAHKKKKAKKAAARILVBasic
NLS Segment(s)
PositionSequence
205-233ARRAKKLCRKIKKAKKAHKKKKAKKAAAR
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MAKKTAMAKKAPNDLSGAEMALMKKRQKRVQDALHLIGTAPLSRIVQMEEEELKTLKLNLGEYRPTREPGNTLRKEIMKLQGHKFHAYCAYAEVWDDVVAEKDLVDAAKHLLENHKGSTVKELQNAFAMLQRYLEASNEIVGYACDLLRRVNDEEAHVLRQLVDVQGGYTITRQDEMFSAICGAFLTIGIKKVTETLSKPFKCAARRAKKLCRKIKKAKKAHKKKKAKKAAARILV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.32
4 0.26
5 0.16
6 0.16
7 0.16
8 0.19
9 0.24
10 0.27
11 0.33
12 0.42
13 0.49
14 0.55
15 0.64
16 0.68
17 0.73
18 0.76
19 0.76
20 0.71
21 0.65
22 0.56
23 0.46
24 0.38
25 0.28
26 0.18
27 0.13
28 0.1
29 0.1
30 0.1
31 0.11
32 0.1
33 0.11
34 0.11
35 0.14
36 0.15
37 0.15
38 0.16
39 0.15
40 0.15
41 0.14
42 0.13
43 0.12
44 0.12
45 0.13
46 0.15
47 0.19
48 0.25
49 0.26
50 0.32
51 0.32
52 0.32
53 0.32
54 0.3
55 0.3
56 0.33
57 0.43
58 0.38
59 0.39
60 0.41
61 0.41
62 0.42
63 0.42
64 0.41
65 0.38
66 0.41
67 0.44
68 0.48
69 0.49
70 0.5
71 0.46
72 0.39
73 0.35
74 0.3
75 0.25
76 0.19
77 0.17
78 0.13
79 0.14
80 0.12
81 0.08
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.06
96 0.06
97 0.06
98 0.09
99 0.12
100 0.13
101 0.14
102 0.17
103 0.16
104 0.16
105 0.21
106 0.24
107 0.23
108 0.26
109 0.26
110 0.23
111 0.23
112 0.23
113 0.18
114 0.15
115 0.14
116 0.1
117 0.1
118 0.09
119 0.09
120 0.09
121 0.09
122 0.07
123 0.06
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.1
137 0.12
138 0.15
139 0.15
140 0.17
141 0.2
142 0.21
143 0.22
144 0.19
145 0.17
146 0.14
147 0.14
148 0.13
149 0.09
150 0.08
151 0.06
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.07
159 0.09
160 0.09
161 0.09
162 0.09
163 0.12
164 0.12
165 0.11
166 0.12
167 0.11
168 0.11
169 0.1
170 0.09
171 0.06
172 0.06
173 0.07
174 0.07
175 0.1
176 0.1
177 0.1
178 0.1
179 0.13
180 0.16
181 0.19
182 0.2
183 0.26
184 0.36
185 0.37
186 0.39
187 0.41
188 0.44
189 0.45
190 0.52
191 0.55
192 0.56
193 0.65
194 0.73
195 0.79
196 0.84
197 0.89
198 0.9
199 0.9
200 0.9
201 0.91
202 0.93
203 0.93
204 0.94
205 0.94
206 0.95
207 0.95
208 0.96
209 0.95
210 0.96
211 0.95
212 0.96
213 0.96
214 0.95
215 0.95
216 0.94