Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BVS6

Protein Details
Accession A0A094BVS6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
201-238SDKRDTPEDRRSRKREHDRKMDERKRHKQKEYIRSLQEBasic
NLS Segment(s)
PositionSequence
210-230RRSRKREHDRKMDERKRHKQK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKPYYHVTHDYRFKTVSSKAEIWIPQKKGPPERKAMHFVPSLKVLSQEVADVNHASRNQDVTDVDYASLNQEVADVDHATYTYGDNGVKDNVTLLSMARKWLCCIGSRKITSKAYATTSCADSGSLLLAWLNNTPVYCLACLNRPNHDSEGVVRFIHIVLRSTPIPASQSQVVAAMKEQPFSGPKPSSLVSSTATGTILASDKRDTPEDRRSRKREHDRKMDERKRHKQKEYIRSLQEQRDSLLEHHISIRNLLERNERLEKENAQLWEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.42
4 0.41
5 0.4
6 0.37
7 0.43
8 0.47
9 0.48
10 0.51
11 0.48
12 0.46
13 0.51
14 0.57
15 0.61
16 0.66
17 0.67
18 0.68
19 0.71
20 0.72
21 0.73
22 0.67
23 0.63
24 0.58
25 0.53
26 0.46
27 0.44
28 0.38
29 0.31
30 0.31
31 0.25
32 0.2
33 0.18
34 0.16
35 0.13
36 0.12
37 0.13
38 0.12
39 0.12
40 0.15
41 0.15
42 0.15
43 0.15
44 0.16
45 0.15
46 0.17
47 0.16
48 0.16
49 0.18
50 0.17
51 0.16
52 0.14
53 0.14
54 0.13
55 0.13
56 0.09
57 0.06
58 0.06
59 0.06
60 0.06
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.07
69 0.06
70 0.07
71 0.08
72 0.08
73 0.09
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.06
82 0.09
83 0.1
84 0.13
85 0.13
86 0.14
87 0.14
88 0.18
89 0.19
90 0.2
91 0.24
92 0.28
93 0.34
94 0.37
95 0.4
96 0.42
97 0.43
98 0.4
99 0.37
100 0.34
101 0.3
102 0.28
103 0.27
104 0.22
105 0.22
106 0.2
107 0.18
108 0.15
109 0.11
110 0.1
111 0.08
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.07
124 0.07
125 0.07
126 0.08
127 0.12
128 0.16
129 0.18
130 0.21
131 0.22
132 0.24
133 0.25
134 0.25
135 0.21
136 0.19
137 0.21
138 0.18
139 0.17
140 0.14
141 0.12
142 0.11
143 0.13
144 0.11
145 0.09
146 0.08
147 0.11
148 0.12
149 0.12
150 0.12
151 0.11
152 0.13
153 0.12
154 0.14
155 0.13
156 0.13
157 0.12
158 0.15
159 0.14
160 0.12
161 0.12
162 0.16
163 0.15
164 0.15
165 0.15
166 0.13
167 0.16
168 0.18
169 0.24
170 0.18
171 0.19
172 0.21
173 0.22
174 0.23
175 0.22
176 0.23
177 0.18
178 0.18
179 0.18
180 0.15
181 0.15
182 0.13
183 0.11
184 0.1
185 0.1
186 0.09
187 0.1
188 0.11
189 0.13
190 0.15
191 0.19
192 0.22
193 0.27
194 0.37
195 0.46
196 0.54
197 0.62
198 0.67
199 0.72
200 0.8
201 0.84
202 0.84
203 0.84
204 0.86
205 0.85
206 0.89
207 0.91
208 0.9
209 0.89
210 0.89
211 0.9
212 0.9
213 0.91
214 0.88
215 0.86
216 0.87
217 0.88
218 0.87
219 0.85
220 0.8
221 0.78
222 0.78
223 0.76
224 0.71
225 0.61
226 0.52
227 0.46
228 0.42
229 0.35
230 0.35
231 0.28
232 0.24
233 0.28
234 0.31
235 0.29
236 0.28
237 0.3
238 0.27
239 0.29
240 0.31
241 0.35
242 0.33
243 0.4
244 0.47
245 0.45
246 0.44
247 0.47
248 0.47
249 0.44
250 0.47
251 0.44