Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AR79

Protein Details
Accession A0A094AR79   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-96DQTQPEKKVVKKRKSWGQQLPEPKTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 16, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSPNIKFELSPAESLIEQFEGSSPNESYPSLFDGMNPSEIDGSEYDYADYERFERAQTDNDSVTAAANGGDQTQPEKKVVKKRKSWGQQLPEPKTNLPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.13
4 0.1
5 0.09
6 0.09
7 0.09
8 0.1
9 0.13
10 0.12
11 0.12
12 0.13
13 0.13
14 0.13
15 0.13
16 0.14
17 0.13
18 0.12
19 0.12
20 0.14
21 0.15
22 0.16
23 0.15
24 0.13
25 0.11
26 0.11
27 0.12
28 0.08
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.08
37 0.06
38 0.06
39 0.07
40 0.07
41 0.09
42 0.1
43 0.14
44 0.17
45 0.18
46 0.18
47 0.18
48 0.18
49 0.16
50 0.15
51 0.1
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.1
60 0.13
61 0.15
62 0.17
63 0.22
64 0.28
65 0.38
66 0.49
67 0.55
68 0.61
69 0.69
70 0.77
71 0.83
72 0.87
73 0.86
74 0.85
75 0.84
76 0.85
77 0.84
78 0.79
79 0.73