FuNGI

A0A094B7K9

Protein Details

Accession

A0A094B7K9

Localization Confidence

High

Confidence Score

22.5

NoLS Segment(s)

Position	Sequence	Protein Nature
67-93	PATANIGKRRPGRPRGSRNRPKEKDAE	Basic
127-148	TPTSQPKRKAGRPPGSKSKPKE	Basic
214-234	IAKPVEKRKRGPRKPSNGVSA	Hydrophilic

NLS Segment(s)

Position	Sequence
73-90	GKRRPGRPRGSRNRPKEK
132-147	PKRKAGRPPGSKSKPK
215-228	AKPVEKRKRGPRKP

Subcellular Location(s)

nucl 22.5, cyto_nucl 14, cyto 4.5

Family & Domain DBs

Amino Acid Sequences

SVADDDDDDAEGAEDDEWVDIGESESILPDKGGANASGAFVPVNSSGTGVIELEPEELNEPESLDPPATANIGKRRPGRPRGSRNRPKEKDAEGNEVPAVEVFSLNQSSGASTSSPVMNMQPASSQTPTSQPKRKAGRPPGSKSKPKETPILPTSIPSSVSPSLSRSNRASVSQTPVPTNNAVAAPQGLSAEERAVLEAYRKSKNAESSASPSIAKPVEKRKRGPRKPSNGVSAEDAAAVPAPAILPPSHSAPVVASQPVEPQRSNSQQATPKSASAGPAAKRQRKSKDLTTAASKTNVAQDVAILKSTPTSTSSSAPVARSVPVTSSQRPVSVPSTTVFSSLPMASEQIMAPYTETATAASATTAAAAAAAAATAPTTRPPPRPTNPLPYLPAPTPILLPTTPNPSASHPHPLRLHSLHTAIPTHLPP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.06
2	0.06
3	0.06
4	0.06
5	0.06
6	0.06
7	0.05
8	0.06
9	0.07
10	0.07
11	0.07
12	0.08
13	0.08
14	0.08
15	0.08
16	0.08
17	0.09
18	0.11
19	0.13
20	0.12
21	0.13
22	0.14
23	0.15
24	0.14
25	0.13
26	0.11
27	0.09
28	0.11
29	0.1
30	0.11
31	0.09
32	0.1
33	0.1
34	0.1
35	0.11
36	0.1
37	0.09
38	0.08
39	0.09
40	0.1
41	0.1
42	0.09
43	0.11
44	0.1
45	0.11
46	0.1
47	0.11
48	0.1
49	0.12
50	0.12
51	0.11
52	0.11
53	0.11
54	0.12
55	0.12
56	0.13
57	0.17
58	0.25
59	0.3
60	0.37
61	0.43
62	0.5
63	0.59
64	0.67
65	0.72
66	0.74
67	0.8
68	0.84
69	0.89
70	0.91
71	0.92
72	0.93
73	0.88
74	0.84
75	0.8
76	0.76
77	0.74
78	0.69
79	0.67
80	0.56
81	0.53
82	0.46
83	0.38
84	0.31
85	0.21
86	0.16
87	0.08
88	0.07
89	0.05
90	0.07
91	0.08
92	0.08
93	0.08
94	0.08
95	0.08
96	0.08
97	0.09
98	0.07
99	0.08
100	0.09
101	0.09
102	0.1
103	0.1
104	0.1
105	0.12
106	0.11
107	0.11
108	0.11
109	0.13
110	0.16
111	0.17
112	0.17
113	0.15
114	0.23
115	0.3
116	0.37
117	0.43
118	0.45
119	0.53
120	0.61
121	0.67
122	0.7
123	0.74
124	0.76
125	0.77
126	0.8
127	0.82
128	0.83
129	0.83
130	0.78
131	0.77
132	0.75
133	0.68
134	0.67
135	0.58
136	0.58
137	0.52
138	0.51
139	0.41
140	0.34
141	0.33
142	0.26
143	0.26
144	0.17
145	0.19
146	0.16
147	0.18
148	0.17
149	0.18
150	0.24
151	0.25
152	0.28
153	0.25
154	0.28
155	0.28
156	0.29
157	0.3
158	0.26
159	0.31
160	0.3
161	0.3
162	0.28
163	0.28
164	0.28
165	0.25
166	0.22
167	0.17
168	0.13
169	0.12
170	0.1
171	0.09
172	0.07
173	0.07
174	0.07
175	0.05
176	0.05
177	0.05
178	0.05
179	0.05
180	0.05
181	0.05
182	0.05
183	0.05
184	0.07
185	0.1
186	0.14
187	0.16
188	0.16
189	0.18
190	0.21
191	0.25
192	0.26
193	0.25
194	0.24
195	0.27
196	0.28
197	0.27
198	0.24
199	0.2
200	0.2
201	0.19
202	0.17
203	0.17
204	0.26
205	0.34
206	0.39
207	0.45
208	0.53
209	0.64
210	0.71
211	0.79
212	0.78
213	0.79
214	0.83
215	0.81
216	0.78
217	0.69
218	0.61
219	0.52
220	0.43
221	0.33
222	0.24
223	0.19
224	0.11
225	0.08
226	0.07
227	0.04
228	0.03
229	0.03
230	0.03
231	0.04
232	0.04
233	0.06
234	0.07
235	0.1
236	0.11
237	0.11
238	0.11
239	0.1
240	0.13
241	0.13
242	0.12
243	0.1
244	0.09
245	0.14
246	0.18
247	0.21
248	0.18
249	0.2
250	0.26
251	0.31
252	0.35
253	0.32
254	0.34
255	0.38
256	0.41
257	0.45
258	0.39
259	0.35
260	0.33
261	0.32
262	0.27
263	0.23
264	0.27
265	0.21
266	0.29
267	0.37
268	0.42
269	0.47
270	0.54
271	0.59
272	0.6
273	0.65
274	0.65
275	0.66
276	0.64
277	0.62
278	0.61
279	0.57
280	0.51
281	0.47
282	0.39
283	0.29
284	0.29
285	0.26
286	0.19
287	0.15
288	0.14
289	0.15
290	0.15
291	0.14
292	0.1
293	0.09
294	0.1
295	0.1
296	0.1
297	0.1
298	0.13
299	0.15
300	0.17
301	0.19
302	0.21
303	0.23
304	0.23
305	0.23
306	0.21
307	0.2
308	0.19
309	0.18
310	0.16
311	0.19
312	0.24
313	0.24
314	0.29
315	0.29
316	0.29
317	0.29
318	0.31
319	0.29
320	0.25
321	0.24
322	0.19
323	0.22
324	0.2
325	0.21
326	0.17
327	0.15
328	0.16
329	0.15
330	0.15
331	0.11
332	0.12
333	0.11
334	0.12
335	0.11
336	0.1
337	0.1
338	0.09
339	0.1
340	0.09
341	0.09
342	0.09
343	0.09
344	0.08
345	0.08
346	0.08
347	0.08
348	0.07
349	0.07
350	0.06
351	0.06
352	0.06
353	0.05
354	0.04
355	0.04
356	0.03
357	0.03
358	0.03
359	0.03
360	0.02
361	0.03
362	0.03
363	0.04
364	0.07
365	0.13
366	0.19
367	0.26
368	0.34
369	0.43
370	0.5
371	0.59
372	0.64
373	0.69
374	0.7
375	0.69
376	0.67
377	0.61
378	0.6
379	0.51
380	0.49
381	0.4
382	0.35
383	0.3
384	0.25
385	0.25
386	0.2
387	0.23
388	0.22
389	0.28
390	0.28
391	0.29
392	0.3
393	0.31
394	0.37
395	0.37
396	0.44
397	0.38
398	0.46
399	0.48
400	0.49
401	0.53
402	0.49
403	0.51
404	0.45
405	0.46
406	0.4
407	0.39
408	0.38
409	0.32

A0A094B7K9

3D AlphaFold-predicted Structure Viewer