Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094B7K9

Protein Details
Accession A0A094B7K9    Localization Confidence High Confidence Score 22.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-93PATANIGKRRPGRPRGSRNRPKEKDAEBasic
127-148TPTSQPKRKAGRPPGSKSKPKEBasic
214-234IAKPVEKRKRGPRKPSNGVSAHydrophilic
NLS Segment(s)
PositionSequence
73-90GKRRPGRPRGSRNRPKEK
132-147PKRKAGRPPGSKSKPK
215-228AKPVEKRKRGPRKP
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences SVADDDDDDAEGAEDDEWVDIGESESILPDKGGANASGAFVPVNSSGTGVIELEPEELNEPESLDPPATANIGKRRPGRPRGSRNRPKEKDAEGNEVPAVEVFSLNQSSGASTSSPVMNMQPASSQTPTSQPKRKAGRPPGSKSKPKETPILPTSIPSSVSPSLSRSNRASVSQTPVPTNNAVAAPQGLSAEERAVLEAYRKSKNAESSASPSIAKPVEKRKRGPRKPSNGVSAEDAAAVPAPAILPPSHSAPVVASQPVEPQRSNSQQATPKSASAGPAAKRQRKSKDLTTAASKTNVAQDVAILKSTPTSTSSSAPVARSVPVTSSQRPVSVPSTTVFSSLPMASEQIMAPYTETATAASATTAAAAAAAAATAPTTRPPPRPTNPLPYLPAPTPILLPTTPNPSASHPHPLRLHSLHTAIPTHLPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.11
19 0.13
20 0.12
21 0.13
22 0.14
23 0.15
24 0.14
25 0.13
26 0.11
27 0.09
28 0.11
29 0.1
30 0.11
31 0.09
32 0.1
33 0.1
34 0.1
35 0.11
36 0.1
37 0.09
38 0.08
39 0.09
40 0.1
41 0.1
42 0.09
43 0.11
44 0.1
45 0.11
46 0.1
47 0.11
48 0.1
49 0.12
50 0.12
51 0.11
52 0.11
53 0.11
54 0.12
55 0.12
56 0.13
57 0.17
58 0.25
59 0.3
60 0.37
61 0.43
62 0.5
63 0.59
64 0.67
65 0.72
66 0.74
67 0.8
68 0.84
69 0.89
70 0.91
71 0.92
72 0.93
73 0.88
74 0.84
75 0.8
76 0.76
77 0.74
78 0.69
79 0.67
80 0.56
81 0.53
82 0.46
83 0.38
84 0.31
85 0.21
86 0.16
87 0.08
88 0.07
89 0.05
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.07
99 0.08
100 0.09
101 0.09
102 0.1
103 0.1
104 0.1
105 0.12
106 0.11
107 0.11
108 0.11
109 0.13
110 0.16
111 0.17
112 0.17
113 0.15
114 0.23
115 0.3
116 0.37
117 0.43
118 0.45
119 0.53
120 0.61
121 0.67
122 0.7
123 0.74
124 0.76
125 0.77
126 0.8
127 0.82
128 0.83
129 0.83
130 0.78
131 0.77
132 0.75
133 0.68
134 0.67
135 0.58
136 0.58
137 0.52
138 0.51
139 0.41
140 0.34
141 0.33
142 0.26
143 0.26
144 0.17
145 0.19
146 0.16
147 0.18
148 0.17
149 0.18
150 0.24
151 0.25
152 0.28
153 0.25
154 0.28
155 0.28
156 0.29
157 0.3
158 0.26
159 0.31
160 0.3
161 0.3
162 0.28
163 0.28
164 0.28
165 0.25
166 0.22
167 0.17
168 0.13
169 0.12
170 0.1
171 0.09
172 0.07
173 0.07
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.07
185 0.1
186 0.14
187 0.16
188 0.16
189 0.18
190 0.21
191 0.25
192 0.26
193 0.25
194 0.24
195 0.27
196 0.28
197 0.27
198 0.24
199 0.2
200 0.2
201 0.19
202 0.17
203 0.17
204 0.26
205 0.34
206 0.39
207 0.45
208 0.53
209 0.64
210 0.71
211 0.79
212 0.78
213 0.79
214 0.83
215 0.81
216 0.78
217 0.69
218 0.61
219 0.52
220 0.43
221 0.33
222 0.24
223 0.19
224 0.11
225 0.08
226 0.07
227 0.04
228 0.03
229 0.03
230 0.03
231 0.04
232 0.04
233 0.06
234 0.07
235 0.1
236 0.11
237 0.11
238 0.11
239 0.1
240 0.13
241 0.13
242 0.12
243 0.1
244 0.09
245 0.14
246 0.18
247 0.21
248 0.18
249 0.2
250 0.26
251 0.31
252 0.35
253 0.32
254 0.34
255 0.38
256 0.41
257 0.45
258 0.39
259 0.35
260 0.33
261 0.32
262 0.27
263 0.23
264 0.27
265 0.21
266 0.29
267 0.37
268 0.42
269 0.47
270 0.54
271 0.59
272 0.6
273 0.65
274 0.65
275 0.66
276 0.64
277 0.62
278 0.61
279 0.57
280 0.51
281 0.47
282 0.39
283 0.29
284 0.29
285 0.26
286 0.19
287 0.15
288 0.14
289 0.15
290 0.15
291 0.14
292 0.1
293 0.09
294 0.1
295 0.1
296 0.1
297 0.1
298 0.13
299 0.15
300 0.17
301 0.19
302 0.21
303 0.23
304 0.23
305 0.23
306 0.21
307 0.2
308 0.19
309 0.18
310 0.16
311 0.19
312 0.24
313 0.24
314 0.29
315 0.29
316 0.29
317 0.29
318 0.31
319 0.29
320 0.25
321 0.24
322 0.19
323 0.22
324 0.2
325 0.21
326 0.17
327 0.15
328 0.16
329 0.15
330 0.15
331 0.11
332 0.12
333 0.11
334 0.12
335 0.11
336 0.1
337 0.1
338 0.09
339 0.1
340 0.09
341 0.09
342 0.09
343 0.09
344 0.08
345 0.08
346 0.08
347 0.08
348 0.07
349 0.07
350 0.06
351 0.06
352 0.06
353 0.05
354 0.04
355 0.04
356 0.03
357 0.03
358 0.03
359 0.03
360 0.02
361 0.03
362 0.03
363 0.04
364 0.07
365 0.13
366 0.19
367 0.26
368 0.34
369 0.43
370 0.5
371 0.59
372 0.64
373 0.69
374 0.7
375 0.69
376 0.67
377 0.61
378 0.6
379 0.51
380 0.49
381 0.4
382 0.35
383 0.3
384 0.25
385 0.25
386 0.2
387 0.23
388 0.22
389 0.28
390 0.28
391 0.29
392 0.3
393 0.31
394 0.37
395 0.37
396 0.44
397 0.38
398 0.46
399 0.48
400 0.49
401 0.53
402 0.49
403 0.51
404 0.45
405 0.46
406 0.4
407 0.39
408 0.38
409 0.32