FuNGI

A0A094DG14

Protein Details

Accession

A0A094DG14

Localization Confidence

Medium

Confidence Score

11.5

NoLS Segment(s)

Position	Sequence	Protein Nature
493-522	QKVRQDKPGARRPAQRKWYRPRAIKKMIVE	Hydrophilic

NLS Segment(s)

Position	Sequence
499-517	KPGARRPAQRKWYRPRAIK

Subcellular Location(s)

nucl 9, cyto 7, mito 6, pero 4

Family & Domain DBs

InterPro	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR017375 PEX12 IPR006845 Pex_N IPR012678 Ribosomal_L23/L15e_core_dom_sf IPR013025 Ribosomal_L25/23
Gene Ontology	GO:0005778 C:peroxisomal membrane GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0008270 F:zinc ion binding GO:0016562 P:protein import into peroxisome matrix, receptor recycling GO:0016567 P:protein ubiquitination GO:0006412 P:translation
Pfam	View protein in Pfam PF04757 Pex2_Pex12 PF00276 Ribosomal_L23

Amino Acid Sequences

MEFMSALQGTFDDHKPSLFELLSEQQLASLIPPSLRYLLTIATHRHPRYLLRVLNSFDELYALCMLIVERHFLKTHGGGFTENFYGLKREKALRGEVPRAQVGAPALVRESLKLTERDIWKNLAVMVGLPYLKAKLDESYEINAPRALLGLAYTQMPQNPTLKQRFMHYYRWFLRNIYPSVNAAYYFSMLAFNLAYLFDNSQFHSPFMWLIGTRMRRLGEADYRAIAALNDPPKRGPGARPGTTSIFSPRTLYPRLLSSMSILLPTSIFALKFLEWWYASDFARQLSKKASESLELPPPIISGINTVALGRKTPATSSSADKAKTEEASDVPENPPIAALSLLPIFTVQLPESSDLCPICEEDVETPTACPTGMTWWLARLKIPIIKRAAAAKKSQARPSLDLWTSIHPNPSSLNITTMATSAAKFARPLRLGTKPVFLPNFTITLTRNPPQTPATHASFIVPLNLNKLDLRDYLFNVYSVRVLGVRSYIQQQKVRQDKPGARRPAQRKWYRPRAIKKMIVEMEQPFAWPEETSDLGAWDKVTYDAAKKEQKSDQEMMGPEAKKKPSLDRESIAEQAARLLEGKDAWKSKDEWEDIGEAMEVEKDVVLPRE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.23
3	0.24
4	0.26
5	0.21
6	0.2
7	0.2
8	0.24
9	0.25
10	0.24
11	0.23
12	0.18
13	0.19
14	0.18
15	0.14
16	0.12
17	0.11
18	0.11
19	0.13
20	0.15
21	0.17
22	0.17
23	0.17
24	0.16
25	0.18
26	0.21
27	0.25
28	0.27
29	0.32
30	0.41
31	0.41
32	0.43
33	0.42
34	0.43
35	0.47
36	0.52
37	0.5
38	0.46
39	0.5
40	0.49
41	0.5
42	0.48
43	0.4
44	0.3
45	0.26
46	0.2
47	0.17
48	0.15
49	0.11
50	0.08
51	0.08
52	0.09
53	0.11
54	0.11
55	0.13
56	0.14
57	0.16
58	0.17
59	0.18
60	0.22
61	0.21
62	0.25
63	0.24
64	0.24
65	0.23
66	0.23
67	0.26
68	0.23
69	0.2
70	0.16
71	0.14
72	0.18
73	0.18
74	0.21
75	0.22
76	0.26
77	0.31
78	0.35
79	0.41
80	0.44
81	0.5
82	0.54
83	0.53
84	0.52
85	0.48
86	0.44
87	0.38
88	0.32
89	0.25
90	0.22
91	0.18
92	0.15
93	0.14
94	0.15
95	0.15
96	0.14
97	0.15
98	0.14
99	0.18
100	0.18
101	0.2
102	0.26
103	0.32
104	0.36
105	0.36
106	0.37
107	0.34
108	0.34
109	0.31
110	0.25
111	0.19
112	0.14
113	0.13
114	0.12
115	0.11
116	0.1
117	0.1
118	0.1
119	0.1
120	0.1
121	0.1
122	0.1
123	0.13
124	0.16
125	0.19
126	0.21
127	0.25
128	0.25
129	0.24
130	0.22
131	0.19
132	0.16
133	0.14
134	0.11
135	0.07
136	0.07
137	0.07
138	0.07
139	0.08
140	0.08
141	0.09
142	0.11
143	0.12
144	0.13
145	0.16
146	0.19
147	0.26
148	0.31
149	0.33
150	0.33
151	0.36
152	0.43
153	0.45
154	0.51
155	0.48
156	0.52
157	0.54
158	0.57
159	0.53
160	0.46
161	0.48
162	0.45
163	0.43
164	0.36
165	0.32
166	0.3
167	0.31
168	0.29
169	0.23
170	0.17
171	0.15
172	0.12
173	0.1
174	0.1
175	0.08
176	0.07
177	0.08
178	0.06
179	0.06
180	0.05
181	0.06
182	0.06
183	0.06
184	0.07
185	0.09
186	0.1
187	0.11
188	0.14
189	0.15
190	0.14
191	0.14
192	0.14
193	0.12
194	0.12
195	0.12
196	0.08
197	0.09
198	0.15
199	0.17
200	0.17
201	0.2
202	0.19
203	0.19
204	0.2
205	0.23
206	0.24
207	0.24
208	0.25
209	0.23
210	0.22
211	0.22
212	0.2
213	0.15
214	0.1
215	0.12
216	0.17
217	0.18
218	0.18
219	0.19
220	0.2
221	0.22
222	0.23
223	0.21
224	0.25
225	0.31
226	0.34
227	0.36
228	0.38
229	0.38
230	0.37
231	0.35
232	0.29
233	0.24
234	0.21
235	0.22
236	0.2
237	0.22
238	0.24
239	0.24
240	0.21
241	0.2
242	0.22
243	0.21
244	0.19
245	0.16
246	0.15
247	0.14
248	0.13
249	0.11
250	0.09
251	0.08
252	0.07
253	0.07
254	0.06
255	0.06
256	0.06
257	0.07
258	0.07
259	0.08
260	0.09
261	0.1
262	0.09
263	0.1
264	0.11
265	0.13
266	0.13
267	0.13
268	0.13
269	0.12
270	0.18
271	0.17
272	0.17
273	0.18
274	0.21
275	0.2
276	0.23
277	0.23
278	0.18
279	0.2
280	0.22
281	0.24
282	0.21
283	0.21
284	0.17
285	0.16
286	0.15
287	0.13
288	0.1
289	0.06
290	0.06
291	0.06
292	0.06
293	0.07
294	0.08
295	0.08
296	0.08
297	0.08
298	0.08
299	0.08
300	0.08
301	0.1
302	0.11
303	0.12
304	0.15
305	0.19
306	0.22
307	0.22
308	0.22
309	0.22
310	0.21
311	0.2
312	0.18
313	0.14
314	0.11
315	0.15
316	0.15
317	0.16
318	0.14
319	0.15
320	0.14
321	0.13
322	0.12
323	0.08
324	0.08
325	0.06
326	0.05
327	0.05
328	0.05
329	0.05
330	0.05
331	0.05
332	0.05
333	0.05
334	0.06
335	0.05
336	0.06
337	0.07
338	0.09
339	0.1
340	0.1
341	0.12
342	0.11
343	0.11
344	0.11
345	0.1
346	0.09
347	0.08
348	0.08
349	0.07
350	0.09
351	0.09
352	0.09
353	0.09
354	0.09
355	0.09
356	0.08
357	0.06
358	0.05
359	0.07
360	0.09
361	0.11
362	0.1
363	0.14
364	0.17
365	0.17
366	0.18
367	0.16
368	0.17
369	0.2
370	0.22
371	0.24
372	0.25
373	0.26
374	0.27
375	0.33
376	0.37
377	0.35
378	0.36
379	0.38
380	0.44
381	0.48
382	0.52
383	0.5
384	0.48
385	0.48
386	0.48
387	0.48
388	0.4
389	0.37
390	0.33
391	0.3
392	0.3
393	0.28
394	0.28
395	0.21
396	0.21
397	0.2
398	0.22
399	0.22
400	0.18
401	0.19
402	0.16
403	0.16
404	0.16
405	0.15
406	0.13
407	0.1
408	0.1
409	0.1
410	0.1
411	0.1
412	0.12
413	0.14
414	0.21
415	0.22
416	0.24
417	0.27
418	0.33
419	0.37
420	0.37
421	0.39
422	0.33
423	0.37
424	0.36
425	0.31
426	0.29
427	0.26
428	0.25
429	0.21
430	0.22
431	0.17
432	0.22
433	0.27
434	0.26
435	0.28
436	0.27
437	0.3
438	0.3
439	0.3
440	0.31
441	0.31
442	0.33
443	0.3
444	0.3
445	0.28
446	0.28
447	0.26
448	0.24
449	0.21
450	0.17
451	0.19
452	0.19
453	0.19
454	0.18
455	0.19
456	0.17
457	0.16
458	0.19
459	0.18
460	0.19
461	0.22
462	0.22
463	0.21
464	0.19
465	0.19
466	0.16
467	0.14
468	0.13
469	0.09
470	0.09
471	0.09
472	0.11
473	0.11
474	0.13
475	0.19
476	0.25
477	0.31
478	0.36
479	0.41
480	0.49
481	0.57
482	0.58
483	0.59
484	0.62
485	0.64
486	0.68
487	0.72
488	0.72
489	0.69
490	0.76
491	0.77
492	0.78
493	0.8
494	0.8
495	0.81
496	0.83
497	0.87
498	0.87
499	0.89
500	0.89
501	0.89
502	0.88
503	0.85
504	0.78
505	0.77
506	0.7
507	0.63
508	0.57
509	0.48
510	0.42
511	0.35
512	0.31
513	0.22
514	0.2
515	0.18
516	0.13
517	0.13
518	0.13
519	0.14
520	0.15
521	0.15
522	0.15
523	0.15
524	0.15
525	0.14
526	0.11
527	0.1
528	0.09
529	0.12
530	0.12
531	0.16
532	0.2
533	0.28
534	0.36
535	0.37
536	0.43
537	0.47
538	0.52
539	0.55
540	0.54
541	0.49
542	0.47
543	0.47
544	0.44
545	0.46
546	0.4
547	0.38
548	0.42
549	0.41
550	0.39
551	0.41
552	0.47
553	0.5
554	0.57
555	0.59
556	0.56
557	0.59
558	0.59
559	0.58
560	0.5
561	0.41
562	0.32
563	0.27
564	0.24
565	0.19
566	0.15
567	0.13
568	0.13
569	0.14
570	0.17
571	0.22
572	0.26
573	0.28
574	0.31
575	0.32
576	0.37
577	0.44
578	0.44
579	0.39
580	0.38
581	0.37
582	0.33
583	0.32
584	0.26
585	0.16
586	0.14
587	0.12
588	0.09
589	0.07
590	0.07
591	0.07

A0A094DG14

3D AlphaFold-predicted Structure Viewer