Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094BR77

Protein Details
Accession A0A094BR77    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
161-182GEKSVEKPTPKKAKAKKRRRAYBasic
NLS Segment(s)
PositionSequence
167-181KPTPKKAKAKKRRRA
Subcellular Location(s) cyto 17.5, cyto_nucl 14, nucl 7.5
Family & Domain DBs
Amino Acid Sequences SIAVAEPEAGEDSTTKPAAQEPAAAQSTDTPPGATDYPAPAHNLPQPPTPPVSNPGAGSIVSQDLAPTSGVASVAPPGSFLTGGGKPWYLENYDPKTRTFEEPPPAVEEAVEEAVAEEVEVEEEVEEEVGRATSDEELSEIDDEEMRDLEEGMDVEMAGVGEKSVEKPTPKKAKAKKRRRAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.17
5 0.2
6 0.2
7 0.22
8 0.19
9 0.25
10 0.26
11 0.26
12 0.23
13 0.23
14 0.24
15 0.23
16 0.22
17 0.15
18 0.14
19 0.17
20 0.18
21 0.15
22 0.14
23 0.14
24 0.16
25 0.17
26 0.2
27 0.18
28 0.2
29 0.25
30 0.29
31 0.28
32 0.31
33 0.32
34 0.31
35 0.34
36 0.32
37 0.28
38 0.27
39 0.28
40 0.25
41 0.23
42 0.22
43 0.2
44 0.18
45 0.17
46 0.14
47 0.1
48 0.09
49 0.08
50 0.06
51 0.05
52 0.06
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.11
76 0.09
77 0.1
78 0.16
79 0.21
80 0.26
81 0.27
82 0.27
83 0.3
84 0.31
85 0.33
86 0.31
87 0.31
88 0.31
89 0.32
90 0.32
91 0.31
92 0.29
93 0.25
94 0.2
95 0.15
96 0.11
97 0.1
98 0.09
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.03
105 0.02
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.08
126 0.08
127 0.08
128 0.07
129 0.08
130 0.08
131 0.09
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.05
150 0.07
151 0.11
152 0.15
153 0.21
154 0.26
155 0.37
156 0.48
157 0.54
158 0.63
159 0.69
160 0.77
161 0.82
162 0.89