Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094BZ20

Protein Details
Accession A0A094BZ20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-56TEGEICPDGKRRRRKRSAPEVATDHydrophilic
NLS Segment(s)
PositionSequence
42-48KRRRRKR
Subcellular Location(s) extr 12, mito 4, plas 3, E.R. 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTSSIFVTTLFASFAVVTLPHILPCPAPRVAYTEGEICPDGKRRRRKRSAPEVATDGLVQEEKPCATTAPIVGGDDLEEIVGTREKRECPIPKPGGTVGRILAFTGIGGSTDGAGGTRPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.07
5 0.1
6 0.1
7 0.1
8 0.11
9 0.12
10 0.13
11 0.14
12 0.18
13 0.16
14 0.16
15 0.16
16 0.21
17 0.23
18 0.24
19 0.23
20 0.22
21 0.21
22 0.22
23 0.22
24 0.17
25 0.16
26 0.22
27 0.29
28 0.34
29 0.45
30 0.54
31 0.64
32 0.74
33 0.82
34 0.84
35 0.88
36 0.9
37 0.84
38 0.76
39 0.69
40 0.59
41 0.5
42 0.39
43 0.27
44 0.16
45 0.12
46 0.09
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.06
64 0.04
65 0.03
66 0.03
67 0.04
68 0.07
69 0.07
70 0.09
71 0.12
72 0.14
73 0.17
74 0.25
75 0.31
76 0.32
77 0.42
78 0.47
79 0.46
80 0.49
81 0.5
82 0.48
83 0.43
84 0.41
85 0.32
86 0.28
87 0.26
88 0.22
89 0.18
90 0.12
91 0.1
92 0.09
93 0.07
94 0.05
95 0.06
96 0.06
97 0.05
98 0.06
99 0.06
100 0.05
101 0.06