Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094AY61

Protein Details
Accession A0A094AY61    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-31SEAGEPRRTRKAYRKRLLCRDDILHydrophilic
76-104RRYQGLKSRKETARRKRQAKSNPAPPEKPBasic
NLS Segment(s)
PositionSequence
75-100PRRYQGLKSRKETARRKRQAKSNPAP
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MATQPDASEAGEPRRTRKAYRKRLLCRDDILSMSERAAEEPVHPQDYSTSFAAESTCHMTWGTLDAGPTYAISKPRRYQGLKSRKETARRKRQAKSNPAPPEKPAFPLLSNLPMELREIVYSHLLISNGPVILHSDWCEVQRNAGLDLGILRVCKIISEEATNFLYQHNIFHALVRDNSAIVRFDQCLYPSYVSLFRNVVIEDTKSTWTVKGLKRTVRSIGTLIESDVTLDSLTLVFAPKTPSEDEVAVEPTDAKNFASLFREESPMMKKLARLRCGVLNLVVKLKLKEKVKVVVSLDIKHLQCDYSTSPLMNEAAAREGRALRAEKAKKELGGLEMTMERIATKWEEAVQLGVCRVMEDGEDLGDGSALMRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.52
4 0.59
5 0.64
6 0.68
7 0.77
8 0.83
9 0.84
10 0.91
11 0.89
12 0.84
13 0.78
14 0.72
15 0.65
16 0.55
17 0.49
18 0.41
19 0.34
20 0.28
21 0.25
22 0.21
23 0.18
24 0.18
25 0.15
26 0.13
27 0.2
28 0.24
29 0.24
30 0.23
31 0.23
32 0.25
33 0.26
34 0.29
35 0.22
36 0.19
37 0.16
38 0.17
39 0.17
40 0.14
41 0.14
42 0.16
43 0.16
44 0.15
45 0.15
46 0.15
47 0.15
48 0.17
49 0.16
50 0.11
51 0.11
52 0.11
53 0.12
54 0.12
55 0.11
56 0.1
57 0.11
58 0.18
59 0.22
60 0.29
61 0.33
62 0.4
63 0.49
64 0.51
65 0.58
66 0.62
67 0.68
68 0.7
69 0.71
70 0.74
71 0.71
72 0.77
73 0.79
74 0.79
75 0.79
76 0.8
77 0.84
78 0.83
79 0.86
80 0.87
81 0.87
82 0.86
83 0.84
84 0.84
85 0.83
86 0.76
87 0.7
88 0.66
89 0.56
90 0.49
91 0.43
92 0.34
93 0.28
94 0.29
95 0.27
96 0.26
97 0.24
98 0.22
99 0.19
100 0.17
101 0.17
102 0.15
103 0.14
104 0.08
105 0.09
106 0.09
107 0.1
108 0.1
109 0.09
110 0.1
111 0.09
112 0.08
113 0.09
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.09
120 0.1
121 0.11
122 0.11
123 0.11
124 0.13
125 0.18
126 0.15
127 0.16
128 0.18
129 0.17
130 0.16
131 0.16
132 0.14
133 0.09
134 0.1
135 0.1
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.11
146 0.11
147 0.14
148 0.15
149 0.15
150 0.14
151 0.12
152 0.14
153 0.11
154 0.11
155 0.09
156 0.11
157 0.11
158 0.12
159 0.14
160 0.14
161 0.14
162 0.16
163 0.14
164 0.11
165 0.11
166 0.11
167 0.1
168 0.09
169 0.1
170 0.09
171 0.09
172 0.1
173 0.1
174 0.11
175 0.13
176 0.12
177 0.11
178 0.12
179 0.16
180 0.15
181 0.16
182 0.15
183 0.13
184 0.14
185 0.14
186 0.13
187 0.09
188 0.1
189 0.09
190 0.11
191 0.11
192 0.11
193 0.12
194 0.11
195 0.13
196 0.2
197 0.23
198 0.3
199 0.35
200 0.39
201 0.42
202 0.45
203 0.46
204 0.4
205 0.38
206 0.3
207 0.27
208 0.23
209 0.2
210 0.17
211 0.13
212 0.11
213 0.09
214 0.08
215 0.07
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.06
225 0.08
226 0.08
227 0.11
228 0.12
229 0.13
230 0.15
231 0.16
232 0.15
233 0.14
234 0.16
235 0.13
236 0.12
237 0.12
238 0.1
239 0.1
240 0.1
241 0.08
242 0.08
243 0.08
244 0.1
245 0.13
246 0.13
247 0.16
248 0.17
249 0.2
250 0.19
251 0.22
252 0.24
253 0.23
254 0.24
255 0.22
256 0.24
257 0.3
258 0.38
259 0.39
260 0.38
261 0.38
262 0.41
263 0.42
264 0.4
265 0.36
266 0.31
267 0.28
268 0.28
269 0.28
270 0.25
271 0.25
272 0.28
273 0.29
274 0.29
275 0.33
276 0.35
277 0.4
278 0.41
279 0.45
280 0.43
281 0.44
282 0.44
283 0.4
284 0.4
285 0.39
286 0.36
287 0.31
288 0.3
289 0.22
290 0.2
291 0.22
292 0.21
293 0.2
294 0.21
295 0.2
296 0.2
297 0.21
298 0.21
299 0.18
300 0.16
301 0.11
302 0.14
303 0.14
304 0.14
305 0.15
306 0.15
307 0.16
308 0.21
309 0.22
310 0.22
311 0.32
312 0.38
313 0.41
314 0.46
315 0.49
316 0.44
317 0.45
318 0.43
319 0.36
320 0.32
321 0.28
322 0.24
323 0.21
324 0.21
325 0.18
326 0.15
327 0.12
328 0.09
329 0.12
330 0.11
331 0.11
332 0.12
333 0.15
334 0.17
335 0.17
336 0.2
337 0.19
338 0.19
339 0.18
340 0.18
341 0.15
342 0.13
343 0.13
344 0.11
345 0.09
346 0.1
347 0.1
348 0.09
349 0.09
350 0.09
351 0.09
352 0.08
353 0.07