FuNGI

C5GRE7

Protein Details

Accession

C5GRE7

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
3-29	LPFNLRPPKLPHSRHNRQTLRNQPLSE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 25

Family & Domain DBs

InterPro	View protein in InterPro IPR031563 MOT1/MOT2
Gene Ontology	GO:0016020 C:membrane GO:0015098 F:molybdate ion transmembrane transporter activity
Pfam	View protein in Pfam PF16983 MFS_MOT1

Amino Acid Sequences

MPLPFNLRPPKLPHSRHNRQTLRNQPLSELSGALGDLGTFLPLLTALAINNTVSLPATLLFSGLYNILTGLFFGIPLPVQPMKAIAAVAIAKHFTPGQIAAAGIFVGACILLFSVTGLLTWFARVVPTPVVKGIQVGAGLSLVISAGASLKSQLGWSGPSWGDNYIWMLVAFVALALTGIYRRVPYGLVVFVVGLGFAFVLLGTSPDQRLPSFGVWRPGVFTPVGDEWRVGIVDAGIGQIPLTTLNSIVAVVYLAGDLLPEVQTPSTTAIGLSVAGMNLLGCWFGAMPVCHGSGGLAAQYRFGARSGASIILLGAFKLIIGLFFGNTLVGLLQRFPKSFLGVMVIAAGLELASVGESLNTSRAWDMVKHPGSGNASGLRLPGSGLNEAEKKQRWTVMMVTVGMLVAFKNDGIGFLAGMVCHWTYKLPALIEEIQRRYGEGRIRLPGSGRGRGSF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.71
2	0.77
3	0.81
4	0.85
5	0.84
6	0.83
7	0.86
8	0.87
9	0.86
10	0.82
11	0.74
12	0.66
13	0.62
14	0.56
15	0.47
16	0.37
17	0.27
18	0.2
19	0.19
20	0.15
21	0.1
22	0.07
23	0.06
24	0.06
25	0.05
26	0.05
27	0.05
28	0.04
29	0.05
30	0.05
31	0.05
32	0.05
33	0.05
34	0.07
35	0.08
36	0.08
37	0.09
38	0.08
39	0.08
40	0.08
41	0.08
42	0.07
43	0.07
44	0.08
45	0.08
46	0.08
47	0.08
48	0.07
49	0.08
50	0.08
51	0.08
52	0.06
53	0.06
54	0.07
55	0.06
56	0.06
57	0.07
58	0.06
59	0.06
60	0.06
61	0.07
62	0.06
63	0.06
64	0.11
65	0.11
66	0.11
67	0.12
68	0.13
69	0.14
70	0.14
71	0.14
72	0.09
73	0.1
74	0.11
75	0.11
76	0.11
77	0.1
78	0.09
79	0.11
80	0.11
81	0.08
82	0.1
83	0.1
84	0.1
85	0.1
86	0.1
87	0.09
88	0.09
89	0.08
90	0.06
91	0.05
92	0.04
93	0.03
94	0.03
95	0.02
96	0.02
97	0.02
98	0.02
99	0.03
100	0.03
101	0.04
102	0.04
103	0.04
104	0.04
105	0.05
106	0.05
107	0.06
108	0.06
109	0.05
110	0.06
111	0.07
112	0.08
113	0.12
114	0.13
115	0.14
116	0.15
117	0.16
118	0.15
119	0.16
120	0.14
121	0.11
122	0.09
123	0.08
124	0.07
125	0.06
126	0.06
127	0.05
128	0.04
129	0.03
130	0.03
131	0.02
132	0.02
133	0.03
134	0.03
135	0.04
136	0.04
137	0.05
138	0.05
139	0.05
140	0.06
141	0.06
142	0.08
143	0.08
144	0.12
145	0.12
146	0.13
147	0.14
148	0.14
149	0.14
150	0.13
151	0.14
152	0.09
153	0.09
154	0.08
155	0.07
156	0.06
157	0.06
158	0.05
159	0.03
160	0.03
161	0.02
162	0.02
163	0.02
164	0.02
165	0.03
166	0.03
167	0.04
168	0.04
169	0.05
170	0.05
171	0.06
172	0.07
173	0.08
174	0.08
175	0.08
176	0.08
177	0.07
178	0.07
179	0.06
180	0.05
181	0.03
182	0.03
183	0.02
184	0.02
185	0.02
186	0.02
187	0.02
188	0.02
189	0.03
190	0.04
191	0.05
192	0.06
193	0.07
194	0.08
195	0.08
196	0.1
197	0.11
198	0.12
199	0.16
200	0.17
201	0.22
202	0.21
203	0.21
204	0.22
205	0.2
206	0.19
207	0.15
208	0.13
209	0.1
210	0.12
211	0.13
212	0.11
213	0.1
214	0.09
215	0.1
216	0.1
217	0.07
218	0.05
219	0.04
220	0.04
221	0.04
222	0.04
223	0.03
224	0.03
225	0.03
226	0.03
227	0.03
228	0.03
229	0.04
230	0.03
231	0.04
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.03
238	0.03
239	0.03
240	0.03
241	0.02
242	0.02
243	0.02
244	0.02
245	0.03
246	0.03
247	0.03
248	0.04
249	0.04
250	0.04
251	0.05
252	0.07
253	0.07
254	0.07
255	0.07
256	0.07
257	0.07
258	0.07
259	0.06
260	0.05
261	0.04
262	0.04
263	0.04
264	0.03
265	0.03
266	0.03
267	0.03
268	0.02
269	0.03
270	0.03
271	0.03
272	0.05
273	0.05
274	0.07
275	0.09
276	0.09
277	0.09
278	0.09
279	0.09
280	0.07
281	0.07
282	0.07
283	0.08
284	0.07
285	0.08
286	0.08
287	0.09
288	0.09
289	0.09
290	0.09
291	0.07
292	0.08
293	0.1
294	0.1
295	0.09
296	0.09
297	0.08
298	0.09
299	0.09
300	0.07
301	0.05
302	0.04
303	0.04
304	0.04
305	0.04
306	0.03
307	0.04
308	0.04
309	0.04
310	0.05
311	0.05
312	0.04
313	0.04
314	0.05
315	0.04
316	0.04
317	0.05
318	0.06
319	0.11
320	0.14
321	0.15
322	0.17
323	0.19
324	0.2
325	0.2
326	0.2
327	0.18
328	0.16
329	0.16
330	0.13
331	0.11
332	0.09
333	0.08
334	0.07
335	0.03
336	0.02
337	0.02
338	0.02
339	0.02
340	0.02
341	0.03
342	0.03
343	0.03
344	0.04
345	0.06
346	0.06
347	0.07
348	0.08
349	0.09
350	0.11
351	0.13
352	0.17
353	0.25
354	0.28
355	0.29
356	0.29
357	0.33
358	0.34
359	0.33
360	0.32
361	0.24
362	0.22
363	0.21
364	0.21
365	0.17
366	0.14
367	0.13
368	0.13
369	0.13
370	0.14
371	0.14
372	0.18
373	0.21
374	0.23
375	0.3
376	0.31
377	0.33
378	0.34
379	0.38
380	0.35
381	0.36
382	0.38
383	0.36
384	0.35
385	0.31
386	0.28
387	0.24
388	0.22
389	0.18
390	0.14
391	0.08
392	0.06
393	0.05
394	0.05
395	0.06
396	0.06
397	0.07
398	0.09
399	0.09
400	0.08
401	0.09
402	0.1
403	0.08
404	0.08
405	0.1
406	0.08
407	0.08
408	0.09
409	0.09
410	0.11
411	0.15
412	0.2
413	0.18
414	0.19
415	0.25
416	0.31
417	0.38
418	0.44
419	0.43
420	0.42
421	0.41
422	0.42
423	0.37
424	0.37
425	0.37
426	0.37
427	0.4
428	0.43
429	0.45
430	0.45
431	0.46
432	0.5
433	0.48
434	0.49

C5GRE7

3D AlphaFold-predicted Structure Viewer