Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5GI41

Protein Details
Accession C5GI41    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21TDGEPTRRRHHQPVSTPSRFHydrophilic
90-110GLHLAHHPRKPQRAPKQFPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MTDGEPTRRRHHQPVSTPSRFDLQEVQQTLTPSCVSYGAHSGERSDSFTHLISLNPAASLAAPANNTSFSTQSGESSMPRFWSVNIVHLGLHLAHHPRKPQRAPKQFPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.76
4 0.71
5 0.63
6 0.58
7 0.48
8 0.4
9 0.36
10 0.3
11 0.33
12 0.33
13 0.33
14 0.3
15 0.31
16 0.29
17 0.25
18 0.21
19 0.13
20 0.12
21 0.11
22 0.09
23 0.1
24 0.13
25 0.14
26 0.15
27 0.15
28 0.15
29 0.16
30 0.16
31 0.17
32 0.14
33 0.13
34 0.13
35 0.13
36 0.13
37 0.12
38 0.11
39 0.1
40 0.1
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.08
54 0.09
55 0.09
56 0.09
57 0.11
58 0.11
59 0.11
60 0.13
61 0.13
62 0.13
63 0.15
64 0.15
65 0.13
66 0.15
67 0.15
68 0.13
69 0.19
70 0.19
71 0.22
72 0.23
73 0.22
74 0.2
75 0.2
76 0.21
77 0.14
78 0.14
79 0.12
80 0.17
81 0.21
82 0.25
83 0.33
84 0.4
85 0.5
86 0.59
87 0.67
88 0.72
89 0.78
90 0.83