Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094ESE4

Protein Details
Accession A0A094ESE4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35ADERKSRLAKLKSLKRKQPSDEDAHydrophilic
NLS Segment(s)
PositionSequence
16-28KSRLAKLKSLKRK
Subcellular Location(s) cyto_nucl 15, nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013169  mRNA_splic_Cwf18-like  
Pfam View protein in Pfam  
PF08315  cwf18  
Amino Acid Sequences MSAAHSSLGAAADERKSRLAKLKSLKRKQPSDEDAAPASPRRSPPGSPDVSKLHLSGRNYDPETRGPKLGFEAPPTQSLEKDTLEQQAADVEAEIRKKTQEEEQDDKGVDIFKLQPKKPNWDLKRDLDKKLEILNVRTDNAIAALVKERIGQAQKSAGDKTGGGAITAAAAADGEQGGDEIGMEGIALVEGARLREQEEKLEEQREKEDEMMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.24
4 0.28
5 0.36
6 0.39
7 0.43
8 0.51
9 0.61
10 0.67
11 0.76
12 0.82
13 0.82
14 0.85
15 0.83
16 0.83
17 0.79
18 0.76
19 0.69
20 0.63
21 0.55
22 0.48
23 0.43
24 0.36
25 0.3
26 0.26
27 0.24
28 0.26
29 0.28
30 0.28
31 0.33
32 0.39
33 0.43
34 0.41
35 0.44
36 0.42
37 0.42
38 0.42
39 0.36
40 0.32
41 0.31
42 0.3
43 0.31
44 0.31
45 0.34
46 0.36
47 0.37
48 0.34
49 0.36
50 0.4
51 0.36
52 0.36
53 0.29
54 0.27
55 0.28
56 0.32
57 0.26
58 0.25
59 0.27
60 0.25
61 0.28
62 0.29
63 0.27
64 0.21
65 0.22
66 0.21
67 0.17
68 0.17
69 0.16
70 0.16
71 0.16
72 0.15
73 0.13
74 0.11
75 0.11
76 0.09
77 0.07
78 0.05
79 0.06
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.15
87 0.21
88 0.27
89 0.32
90 0.35
91 0.36
92 0.36
93 0.34
94 0.29
95 0.22
96 0.14
97 0.1
98 0.11
99 0.14
100 0.2
101 0.21
102 0.29
103 0.31
104 0.39
105 0.45
106 0.53
107 0.52
108 0.54
109 0.59
110 0.59
111 0.68
112 0.64
113 0.6
114 0.54
115 0.51
116 0.44
117 0.42
118 0.38
119 0.29
120 0.27
121 0.29
122 0.26
123 0.26
124 0.24
125 0.21
126 0.16
127 0.15
128 0.14
129 0.07
130 0.06
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.12
137 0.15
138 0.15
139 0.15
140 0.19
141 0.22
142 0.24
143 0.24
144 0.22
145 0.2
146 0.2
147 0.19
148 0.18
149 0.15
150 0.12
151 0.11
152 0.1
153 0.09
154 0.09
155 0.07
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.02
176 0.04
177 0.05
178 0.06
179 0.08
180 0.08
181 0.11
182 0.17
183 0.19
184 0.24
185 0.28
186 0.34
187 0.37
188 0.45
189 0.46
190 0.42
191 0.46
192 0.43
193 0.4