Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q758Q1

Protein Details
Accession Q758Q1   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
278-299LIAFKPCTSCSKRKNCFCTFSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, extr 10, cyto_nucl 7, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG ago:AGOS_AEL298C  -  
CDD cd00067  GAL4  
Amino Acid Sequences MLSSIAIDNQHADKTLPPLLLLPPVIHTEAQAAGGTGATTPVSSYDAGLAGYGAGYEEGEADAAAEHKPVSPYSETSTTSSSLERLAFLATRKGDGSGQYGAAPDAYYVGRQAPAYQTPFYGGTVAPGAARSLTPNGAPRLQYEATYNTPRSPESARGVSMSPLMSESASGFQRGDVQRTGSPPNSLLQEPTVITASKYKRQRTGPSCDICRSKKIKCDATITILFQDASVTGSFNEMLHAPVNVSELANEWLSQIPDEVRQALLTKELTLLKHVDKLIAFKPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDYRNCGYQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.2
5 0.21
6 0.22
7 0.25
8 0.23
9 0.19
10 0.17
11 0.19
12 0.21
13 0.19
14 0.17
15 0.16
16 0.15
17 0.16
18 0.14
19 0.11
20 0.09
21 0.09
22 0.09
23 0.07
24 0.07
25 0.05
26 0.05
27 0.05
28 0.06
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.09
56 0.09
57 0.13
58 0.15
59 0.17
60 0.21
61 0.26
62 0.26
63 0.27
64 0.29
65 0.26
66 0.25
67 0.23
68 0.19
69 0.17
70 0.15
71 0.13
72 0.12
73 0.12
74 0.12
75 0.13
76 0.18
77 0.16
78 0.17
79 0.16
80 0.17
81 0.17
82 0.17
83 0.19
84 0.15
85 0.15
86 0.14
87 0.14
88 0.13
89 0.12
90 0.1
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.08
99 0.1
100 0.11
101 0.16
102 0.19
103 0.18
104 0.18
105 0.18
106 0.19
107 0.18
108 0.16
109 0.12
110 0.09
111 0.1
112 0.1
113 0.08
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.13
123 0.15
124 0.17
125 0.17
126 0.17
127 0.22
128 0.21
129 0.21
130 0.19
131 0.2
132 0.22
133 0.26
134 0.25
135 0.21
136 0.21
137 0.21
138 0.21
139 0.2
140 0.21
141 0.21
142 0.22
143 0.21
144 0.21
145 0.22
146 0.2
147 0.18
148 0.14
149 0.1
150 0.08
151 0.08
152 0.07
153 0.06
154 0.06
155 0.07
156 0.08
157 0.08
158 0.07
159 0.07
160 0.14
161 0.15
162 0.17
163 0.15
164 0.17
165 0.18
166 0.21
167 0.24
168 0.18
169 0.19
170 0.17
171 0.18
172 0.18
173 0.16
174 0.15
175 0.12
176 0.12
177 0.11
178 0.12
179 0.11
180 0.09
181 0.09
182 0.15
183 0.18
184 0.23
185 0.3
186 0.33
187 0.39
188 0.45
189 0.55
190 0.55
191 0.61
192 0.62
193 0.62
194 0.62
195 0.6
196 0.61
197 0.53
198 0.56
199 0.52
200 0.47
201 0.48
202 0.52
203 0.54
204 0.51
205 0.55
206 0.49
207 0.49
208 0.48
209 0.41
210 0.34
211 0.28
212 0.23
213 0.17
214 0.15
215 0.09
216 0.08
217 0.07
218 0.06
219 0.06
220 0.07
221 0.07
222 0.07
223 0.08
224 0.07
225 0.08
226 0.08
227 0.08
228 0.07
229 0.07
230 0.09
231 0.08
232 0.08
233 0.07
234 0.08
235 0.1
236 0.1
237 0.09
238 0.09
239 0.1
240 0.11
241 0.11
242 0.1
243 0.09
244 0.12
245 0.13
246 0.13
247 0.11
248 0.12
249 0.13
250 0.12
251 0.14
252 0.13
253 0.12
254 0.14
255 0.17
256 0.16
257 0.18
258 0.21
259 0.19
260 0.24
261 0.24
262 0.23
263 0.21
264 0.25
265 0.28
266 0.32
267 0.31
268 0.3
269 0.34
270 0.35
271 0.43
272 0.46
273 0.51
274 0.54
275 0.64
276 0.71
277 0.77
278 0.82
279 0.81
280 0.82
281 0.76
282 0.76
283 0.7
284 0.68
285 0.66
286 0.61
287 0.55
288 0.5
289 0.5
290 0.42
291 0.41
292 0.36
293 0.31
294 0.31
295 0.31
296 0.29
297 0.3
298 0.28
299 0.25
300 0.23
301 0.22
302 0.27
303 0.3
304 0.37
305 0.35
306 0.43
307 0.5
308 0.57
309 0.57
310 0.51
311 0.49
312 0.48
313 0.51
314 0.47
315 0.41
316 0.36
317 0.36