Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094FH26

Protein Details
Accession A0A094FH26   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-101CPPTRRRRGYPVTRGRNEKRBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR016654  U6_snRNA_Lsm2  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01725  LSm2  
Amino Acid Sequences MLFFSFFKTLVDQEVTVELKNDIQIRGTLKSVDQYLNIKLDDISVVEEIKYPHLVSMEPAPDYAPAFVRQERIHQRKCGEICPPTRRRRGYPVTRGRNEKRSCPTSIESESSINEVMGDDFGEGIRKRHVATAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.18
4 0.18
5 0.15
6 0.14
7 0.17
8 0.18
9 0.14
10 0.14
11 0.17
12 0.19
13 0.2
14 0.2
15 0.18
16 0.16
17 0.19
18 0.2
19 0.19
20 0.18
21 0.19
22 0.2
23 0.22
24 0.21
25 0.19
26 0.16
27 0.15
28 0.13
29 0.1
30 0.09
31 0.07
32 0.07
33 0.07
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.08
52 0.08
53 0.1
54 0.11
55 0.14
56 0.14
57 0.21
58 0.31
59 0.38
60 0.4
61 0.43
62 0.43
63 0.47
64 0.49
65 0.44
66 0.4
67 0.37
68 0.41
69 0.46
70 0.55
71 0.56
72 0.62
73 0.64
74 0.63
75 0.66
76 0.69
77 0.69
78 0.71
79 0.74
80 0.75
81 0.77
82 0.82
83 0.78
84 0.78
85 0.72
86 0.69
87 0.67
88 0.61
89 0.58
90 0.54
91 0.51
92 0.47
93 0.48
94 0.43
95 0.36
96 0.33
97 0.31
98 0.27
99 0.25
100 0.18
101 0.14
102 0.11
103 0.09
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.11
110 0.12
111 0.13
112 0.17
113 0.18
114 0.19
115 0.24
116 0.28