Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094ES78

Protein Details
Accession A0A094ES78    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-35IQHAGKRKKAAKAPTKKKNEPLATTHydrophilic
NLS Segment(s)
PositionSequence
15-28GKRKKAAKAPTKKK
Subcellular Location(s) nucl 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MVRTPLPPADIQHAGKRKKAAKAPTKKKNEPLATTFPCLFCNHEKSVTAKIDKKAGVGHLSCKVCDQSFSCSINYLSLPVDVYSEWVDACDTVAQENKEANASRSRNPALPGRAGEPERVDDDLDDEDVDRHNGYGGEGIVDDEEDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.55
4 0.55
5 0.57
6 0.62
7 0.64
8 0.65
9 0.73
10 0.8
11 0.82
12 0.86
13 0.84
14 0.85
15 0.85
16 0.82
17 0.77
18 0.72
19 0.71
20 0.65
21 0.62
22 0.55
23 0.45
24 0.39
25 0.34
26 0.31
27 0.27
28 0.29
29 0.28
30 0.28
31 0.29
32 0.3
33 0.35
34 0.36
35 0.36
36 0.36
37 0.35
38 0.38
39 0.37
40 0.35
41 0.3
42 0.27
43 0.26
44 0.22
45 0.23
46 0.24
47 0.25
48 0.24
49 0.23
50 0.22
51 0.18
52 0.19
53 0.17
54 0.15
55 0.2
56 0.22
57 0.21
58 0.21
59 0.21
60 0.2
61 0.18
62 0.14
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.05
79 0.06
80 0.09
81 0.09
82 0.11
83 0.11
84 0.11
85 0.14
86 0.14
87 0.16
88 0.21
89 0.23
90 0.26
91 0.32
92 0.34
93 0.33
94 0.35
95 0.4
96 0.35
97 0.36
98 0.34
99 0.31
100 0.34
101 0.33
102 0.32
103 0.28
104 0.26
105 0.25
106 0.24
107 0.21
108 0.16
109 0.17
110 0.15
111 0.14
112 0.12
113 0.1
114 0.1
115 0.11
116 0.12
117 0.1
118 0.09
119 0.1
120 0.1
121 0.1
122 0.11
123 0.1
124 0.1
125 0.1
126 0.1
127 0.09
128 0.09