Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094HMS8

Protein Details
Accession A0A094HMS8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LPMMGYQKYRKHKARKALKKELRAQPEQHydrophilic
NLS Segment(s)
PositionSequence
21-32RKHKARKALKKE
Subcellular Location(s) cyto_nucl 7.5, nucl 7, mito 7, cyto 6, E.R. 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002777  PFD_beta-like  
IPR016661  PFDN4  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
Amino Acid Sequences MAAVVLMAIVVLPMMGYQKYRKHKARKALKKELRAQPEQLQGGHQASWEQSRDQPPSYDDIVGSHPSPPYSPNRPPGYIQRTSGNRGLPVGHLPGSYLSPTALSKEDEAATGADEIEVRREDQDKINKFSRLHQRELNLEDELKAKHKEKEDLEDISNELELADDEDMIPYQIGDSFISLPLPEVQELLSTNTTRIEEEVSVLEEKLGTIKEGMQELKVELYARFGRSINLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.09
4 0.15
5 0.24
6 0.34
7 0.44
8 0.53
9 0.63
10 0.7
11 0.79
12 0.84
13 0.87
14 0.88
15 0.89
16 0.89
17 0.88
18 0.89
19 0.88
20 0.85
21 0.78
22 0.73
23 0.69
24 0.67
25 0.6
26 0.5
27 0.42
28 0.37
29 0.34
30 0.29
31 0.22
32 0.15
33 0.15
34 0.19
35 0.19
36 0.17
37 0.21
38 0.27
39 0.3
40 0.31
41 0.31
42 0.29
43 0.32
44 0.32
45 0.27
46 0.21
47 0.19
48 0.2
49 0.2
50 0.19
51 0.16
52 0.15
53 0.14
54 0.15
55 0.16
56 0.2
57 0.26
58 0.31
59 0.38
60 0.42
61 0.44
62 0.46
63 0.53
64 0.53
65 0.49
66 0.45
67 0.44
68 0.43
69 0.45
70 0.46
71 0.37
72 0.3
73 0.27
74 0.26
75 0.2
76 0.18
77 0.16
78 0.13
79 0.11
80 0.11
81 0.11
82 0.11
83 0.1
84 0.08
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.11
94 0.1
95 0.1
96 0.09
97 0.08
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.09
108 0.1
109 0.16
110 0.25
111 0.27
112 0.32
113 0.35
114 0.39
115 0.38
116 0.44
117 0.49
118 0.46
119 0.46
120 0.44
121 0.43
122 0.43
123 0.45
124 0.39
125 0.29
126 0.24
127 0.21
128 0.2
129 0.18
130 0.17
131 0.18
132 0.19
133 0.22
134 0.26
135 0.31
136 0.32
137 0.38
138 0.39
139 0.38
140 0.37
141 0.33
142 0.3
143 0.24
144 0.21
145 0.14
146 0.09
147 0.06
148 0.05
149 0.05
150 0.05
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.05
160 0.06
161 0.06
162 0.07
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.1
169 0.11
170 0.1
171 0.09
172 0.09
173 0.1
174 0.11
175 0.14
176 0.15
177 0.14
178 0.14
179 0.16
180 0.17
181 0.16
182 0.16
183 0.15
184 0.12
185 0.14
186 0.14
187 0.15
188 0.15
189 0.14
190 0.13
191 0.11
192 0.1
193 0.11
194 0.1
195 0.09
196 0.09
197 0.11
198 0.13
199 0.17
200 0.18
201 0.17
202 0.18
203 0.18
204 0.19
205 0.18
206 0.16
207 0.13
208 0.18
209 0.21
210 0.22
211 0.24
212 0.23
213 0.24